PDB entry 1vrc

View 1vrc on RCSB PDB site
Description: Complex of enzyme IIAmannose and the histidine-containing phosphocarrier protein HPr from escherichia coli nmr, restrained regularized mean structure
Class: transferase
Keywords: phosphotransferase, transferase, kinase, sugar transport, complex (transferase/phosphocarrier)
Deposited on 2005-02-21, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PTS system, mannose-specific IIAB component
    Species: Escherichia coli [TaxId:562]
    Gene: manX, gptB, ptsL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vrca_
  • Chain 'B':
    Compound: PTS system, mannose-specific IIAB component
    Species: Escherichia coli [TaxId:562]
    Gene: manX, gptB, ptsL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vrcb_
  • Chain 'C':
    Compound: Phosphocarrier protein HPr
    Species: Escherichia coli [TaxId:562]
    Gene: ptsH, hpr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vrcc_
  • Chain 'D':
    Compound: Phosphocarrier protein HPr
    Species: Escherichia coli [TaxId:562]
    Gene: ptsH, hpr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vrcd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vrcA (A:)
    mtiaivigthgwaaeqllktaemllgeqenvgwidfvpgenaetliekynaqlakldttk
    gvlflvdtwggspfnaasrivvdkehyeviagvnipmlvetlmardddpsfdelvalave
    tgregvkalkakpfag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vrcA (A:)
    tiaivigthgwaaeqllktaemllgeqenvgwidfvpgenaetliekynaqlakldttkg
    vlflvdtwggspfnaasrivvdkehyeviagvnipmlvetlmardddpsfdelvalavet
    gregvkalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vrcB (B:)
    mtiaivigthgwaaeqllktaemllgeqenvgwidfvpgenaetliekynaqlakldttk
    gvlflvdtwggspfnaasrivvdkehyeviagvnipmlvetlmardddpsfdelvalave
    tgregvkalkakpfag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vrcB (B:)
    tiaivigthgwaaeqllktaemllgeqenvgwidfvpgenaetliekynaqlakldttkg
    vlflvdtwggspfnaasrivvdkehyeviagvnipmlvetlmardddpsfdelvalavet
    gregvkalk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vrcC (C:)
    mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
    vtisaegedeqkavehlvklmaele
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vrcD (D:)
    mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
    vtisaegedeqkavehlvklmaele