PDB entry 1vra

View 1vra on RCSB PDB site
Description: Crystal structure of Arginine biosynthesis bifunctional protein argJ (10175521) from Bacillus halodurans at 2.00 A resolution
Deposited on 2005-02-17, released 2005-04-12
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.141
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginine biosynthesis bifunctional protein argJ
    Species: Bacillus halodurans [TaxId:86665]
    Gene: argJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K8V3 (Start-207)
      • modified residue (92)
      • modified residue (114)
      • modified residue (143)
      • modified residue (201)
      • modified residue (206)
  • Chain 'B':
    Compound: Arginine biosynthesis bifunctional protein argJ
    Species: Bacillus halodurans [TaxId:86665]
    Gene: argJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K8V3 (0-End)
      • modified residue (1)
      • modified residue (42)
      • modified residue (46)
      • see remark 999 (55)
      • modified residue (107)
  • Heterogens: SO4, UNL, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1vraA (A:)
    mgsdkihhhhhhmnvinetanvlkletgsvtsakgfsavgihtgvkrkrkdlgaivcevp
    assaavytlnkvqaaplkvtqesiavegklqamivnsgianactgkrglddaytmravga
    etfhipehyvavtstgvigeflpmdvitngirqlkpeatiegahafneailttdtvekht
    cyqtivngktvtvggvakgsgmihpnma
    

    Sequence, based on observed residues (ATOM records):
    >1vraA (A:)
    etanvlkletgsvtsakgfsavgihtgvkrkrkdlgaivcevpassaavytlnkvqaapl
    kvtqesiavegklqamivnsgianactgkrglddaytmravgaetfhipehyvavtstgv
    igeflpmdvitngirqlkpeatiegahafneailttdtvekhtcyqtivngktvtvggva
    kgsgmihpnma
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1vraB (B:)
    tmlsfvttdanidhghlqgalsaitnetfnritvdgdtstndmvvvmasglaenetltpe
    hpdwanfykalqlacedlakqiardgegatklievevtgaandqeagmvakqivgsdlvk
    taiygadanwgriicaigysgcevnqetidiaigpivtlkqseptgfseeeataylkead
    pvkisvnlhigngtgkawgcdltydyvrinagyrt
    

    Sequence, based on observed residues (ATOM records):
    >1vraB (B:)
    tmlsfvttdanidhghlqgalsaitnetfnritvdgdtstndmvvvmasglaenetltpe
    hpdwanfykalqlacedlakqiardgegatklievevtgaandqeagmvakqivgsdlvk
    taiygadanwgriicaigysgcevnqetidiaigpivtlkqseptgfseeeataylkead
    pvkisvnlhigngtgkawgcdltydyvrinagy