PDB entry 1vr9

View 1vr9 on RCSB PDB site
Description: crystal structure of a cbs domain pair/act domain protein (tm0892) from thermotoga maritima at 1.70 a resolution
Class: unknown function
Keywords: structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, unknown function
Deposited on 2005-02-17, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.247
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CBS domain protein/ACT domain protein
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0892
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZZ4 (12-End)
      • modified residue (12)
      • modified residue (24)
      • modified residue (38)
      • modified residue (112)
    Domains in SCOPe 2.07: d1vr9a3
  • Chain 'B':
    Compound: CBS domain protein/ACT domain protein
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0892
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZZ4 (12-End)
      • modified residue (12)
      • modified residue (24)
      • modified residue (38)
      • modified residue (112)
    Domains in SCOPe 2.07: d1vr9b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vr9A (A:)
    mgsdkihhhhhhmkvkkwvtqdfpmveesatvreclhrmrqyqtnecivkdreghfrgvv
    nkedlldldldssvfnkvslpdffvheednithalllflehqepylpvvdeemrlkgavs
    lhdflealiealamdvpgirfsvlledkpgelrkvvdalalsninilsvittrsgdgkre
    vlikvdavdegtliklfeslgikiesiekeegf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vr9A (A:)
    mkvkkwvtqdfpmveesatvreclhrmrqyqtnecivkdreghfrgvvnkedlldldlds
    svfnkvslpdffvheednithalllflehqepylpvvdeemrlkgavslhdflealieal
    a
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vr9B (B:)
    mgsdkihhhhhhmkvkkwvtqdfpmveesatvreclhrmrqyqtnecivkdreghfrgvv
    nkedlldldldssvfnkvslpdffvheednithalllflehqepylpvvdeemrlkgavs
    lhdflealiealamdvpgirfsvlledkpgelrkvvdalalsninilsvittrsgdgkre
    vlikvdavdegtliklfeslgikiesiekeegf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vr9B (B:)
    mkvkkwvtqdfpmveesatvreclhrmrqyqtnecivkdreghfrgvvnkedlldldlds
    svfnkvslpdffvheednithalllflehqepylpvvdeemrlkgavslhdflealieal
    a