PDB entry 1vr8

View 1vr8 on RCSB PDB site
Description: Crystal structure of GTP binding regulator (TM1622) from Thermotoga Maritima at 1.75 A resolution
Class: signaling protein
Keywords: TM1622, GTP BINDING REGULATOR, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, SIGNALING PROTEIN
Deposited on 2005-02-16, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.15
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP binding regulator
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1622
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1V7 (12-141)
      • leader sequence (4-11)
      • modified residue (46)
      • modified residue (95)
      • modified residue (139)
    Domains in SCOPe 2.07: d1vr8a1, d1vr8a2
  • Heterogens: AZI, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vr8A (A:)
    mgsdkihhhhhhppeaysldtaifvletrdyrlsdvkeidsygdvemkgkvavfeteygp
    vflyvykgeeakkiwkklngragfvsirsvldlpnmgkfstvsngkkivawwrknwlfiv
    egkngveefvkhvyrvyeemkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vr8A (A:)
    kihhhhhhppeaysldtaifvletrdyrlsdvkeidsygdvemkgkvavfeteygpvfly
    vykgeeakkiwkklngrvsirsvldlpnmgkfstvsngkkivawwrknwlfivegkngve
    efvkhvyrvyeemkq