PDB entry 1vr4

View 1vr4 on RCSB PDB site
Description: Crystal Structure of MCSG TArget APC22750 from Bacillus cereus
Class: structural genomics, unknown function
Keywords: Structural Genomics, Pentamer, Hypothetical Protein, PSI, Protein Structure Initiative, The Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-01-31, released 2005-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein APC22750
    Species: Bacillus cereus [TaxId:226900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vr4a1
  • Chain 'B':
    Compound: hypothetical protein APC22750
    Species: Bacillus cereus [TaxId:226900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vr4b_
  • Chain 'C':
    Compound: hypothetical protein APC22750
    Species: Bacillus cereus [TaxId:226900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vr4c_
  • Chain 'D':
    Compound: hypothetical protein APC22750
    Species: Bacillus cereus [TaxId:226900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vr4d_
  • Chain 'E':
    Compound: hypothetical protein APC22750
    Species: Bacillus cereus [TaxId:226900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vr4e_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vr4A (A:)
    mivtttsgiqgkeiieyidivngeaimganivrdlfasvrdvvggragsyesklkeardi
    amdemkelakqkganaivgvdvdyevvrdgmlmvavsgtavri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vr4B (B:)
    mivtttsgiqgkeiieyidivngeaimganivrdlfasvrdvvggragsyesklkeardi
    amdemkelakqkganaivgvdvdyevvrdgmlmvavsgtavri
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vr4B (B:)
    mivtttsgiqgkeiieyidivngeaimgaesklkeardiamdemkelakqkganaivgvd
    vdyevvrdgmlmvavsgtavri
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vr4C (C:)
    mivtttsgiqgkeiieyidivngeaimganivrdlfasvrdvvggragsyesklkeardi
    amdemkelakqkganaivgvdvdyevvrdgmlmvavsgtavri
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vr4C (C:)
    mivtttsgiqgkeiieyidivngeaimganivrdlfasvggragsyesklkeardiamde
    mkelakqkganaivgvdvdyevvrdgmlmvavsgtavri
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vr4D (D:)
    mivtttsgiqgkeiieyidivngeaimganivrdlfasvrdvvggragsyesklkeardi
    amdemkelakqkganaivgvdvdyevvrdgmlmvavsgtavri
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vr4E (E:)
    mivtttsgiqgkeiieyidivngeaimganivrdlfasvrdvvggragsyesklkeardi
    amdemkelakqkganaivgvdvdyevvrdgmlmvavsgtavri
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vr4E (E:)
    mivtttsgiqgkeiieyidivngeaimgardvvggragsyesklkeardiamdemkelak
    qkganaivgvdvdyevvrdgmlmvavsgtavri