PDB entry 1vr3

View 1vr3 on RCSB PDB site
Description: Crystal structure of Acireductone dioxygenase (13543033) from Mus musculus at 2.06 A resolution
Class: oxidoreductase
Keywords: 13543033, ACIREDUCTONE DIOXYGENASE, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, OXIDOREDUCTASE
Deposited on 2005-01-28, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.164
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acireductone dioxygenase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99JT9 (12-190)
      • modified residue (12)
      • modified residue (18)
      • modified residue (69)
      • modified residue (75)
      • modified residue (94)
      • modified residue (130)
      • modified residue (135)
      • modified residue (157)
      • modified residue (183)
    Domains in SCOPe 2.07: d1vr3a1
  • Heterogens: NI, UNL, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vr3A (A:)
    mgsdkihhhhhhmvqawymdestadprkphraqpdrpvsleqlrtlgvlywkldadkyen
    dpelekirkmrnyswmdiitickdtlpnyeekikmffeehlhldeeiryilegsgyfdvr
    dkedkwirismekgdmitlpagiyhrftldeknyvkamrlfvgepvwtpynrpadhfdar
    vqymsflegta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vr3A (A:)
    mvqawymdestadprkphraqpdrpvsleqlrtlgvlywkldadkyendpelekirkmrn
    yswmdiitickdtlpnyeekikmffeehlhldeeiryilegsgyfdvrdkedkwirisme
    kgdmitlpagiyhrftldeknyvkamrlfvgepvwtpynrpadhfdarvqymsflegta