PDB entry 1vr2

View 1vr2 on RCSB PDB site
Description: human vascular endothelial growth factor receptor 2 (kdr) kinase domain
Class: transferase
Keywords: tyrosine kinase, transferase
Deposited on 1998-12-03, released 2000-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (vascular endothelial growth factor receptor kinase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vr2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vr2A (A:)
    mdpdelpldehcerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtv
    avkmlkegathsehralmselkilihighhlnvvnllgactkpggplmvivefckfgnls
    tylrskrnefvpykvapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnil
    lseknvvkicdfglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvll
    weifslgaspypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfse
    lvehlgnllqanaqqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vr2A (A:)
    lpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkegathseh
    ralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpyk
    dfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfdarlplkwma
    petifdrvytiqsdvwsfgvllweifslgaspypgvkideefcrrlkegtrmrapdyttp
    emyqtmldcwhgepsqrptfselvehlgnllqana