PDB entry 1vr1

View 1vr1 on RCSB PDB site
Description: Specifity for Plasminogen Activator Inhibitor-1
Class: blood clotting/hydrolase inhibitor
Keywords: thrombin, blood clotting-hydrolase inhibitor complex
Deposited on 1998-12-11, released 1998-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-End)
      • gap in sws p00734 (19-21)
      • conflict (21)
      • conflict (21)
      • gap in sws p00734 (28)
      • conflict (29)
      • conflict (192)
    Domains in SCOPe 2.07: d1vr1.1
  • Chain 'I':
    Compound: hirudin
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vr1.1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1vr1H (H:)
    ivegsdaeigmspwqvmlfakhrrspgerflcgaslisdrwvltaahcllyppwdknfte
    ndllvrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyih
    pvclpdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckds
    triritdnmfcayykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgk
    ygfythvfrlkkwiqkvidqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vr1H (H:)
    ivegsdaeigmspwqvmlfakherflcgaslisdrwvltaahcllyppwdknftendllv
    rigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvclp
    dretaasllqagykgrvtgwgnlketgqpsvlqvvnlpiverpvckdstriritdnmfca
    yykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkk
    wiqkvid
    

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vr1L (L:)
    adcglrplfekksledkterellesyi