PDB entry 1vqz

View 1vqz on RCSB PDB site
Description: Crystal structure of a putative lipoate-protein ligase a (sp_1160) from streptococcus pneumoniae tigr4 at 1.99 A resolution
Class: ligase
Keywords: Class ii aars and biotin synthetases fold, sufe/nifu fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, ligase
Deposited on 2005-01-21, released 2005-02-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.162
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipoate-protein ligase, putative
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Gene: np_345629.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97QP1 (12-340)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (155)
      • modified residue (216)
      • modified residue (223)
    Domains in SCOPe 2.06: d1vqza1, d1vqza2, d1vqza3
  • Heterogens: UNL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vqzA (A:)
    mgsdkihhhhhhmkyiinhsndtafnialeeyafkhlldedqifllwinkpsiivgrhqn
    tieeinrdyvrengievvrrisgggavyhdlnnlnytiiskedenkafdfksfstpvint
    laqlgvkaeftgrndleidgkkfcgnaqayingrimhhgcllfdvdlsvlanalkvskdk
    feskgvksvrarvtniinelpkkitvekfrdllleymkkeypemteyvfseeelaeinri
    kdtkfgtwdwnygkspefnvrrgikftsgkvevfanvteskiqdikiygdffgiedvaav
    edvlrgvkyeredvlkalktiditryfagisreeiaeavvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqzA (A:)
    hmkyiinhsndtafnialeeyafkhlldedqifllwinkpsiivgrhqntieeinrdyvr
    engievvrrisgggavyhdlnnlnytiiskedenkafdfksfstpvintlaqlgvkaeft
    grndleidgkkfcgnaqayingrimhhgcllfdvdlsvlanalkvskdkfeskgvksvra
    rvtniinelpkkitvekfrdllleymkkeypemteyvfseeelaeinrikdtkfgtwdwn
    ygkspefnvrrgikftsgkvevfanvteskiqdikiygdffgiedvaavedvlrgvkyer
    edvlkalktiditryfagisreeiaeavvg