PDB entry 1vqz

View 1vqz on RCSB PDB site
Description: Crystal structure of putative Lipoate-protein ligase (np_345629.1) from Streptococcus pneumoniae tigr4 at 1.99 A resolution
Class: structural genomics, unknown function
Keywords: np_345629.1, LIPOATE-PROTEIN LIGASE, PUTATIVE, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI
Deposited on 2005-01-21, released 2005-02-15
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.162
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipoate-protein ligase, putative
    Species: Streptococcus pneumoniae TIGR4
    Gene: np_345629.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97QP1 (12-340)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (155)
      • modified residue (216)
      • modified residue (223)
    Domains in SCOP 1.73: d1vqza1, d1vqza2
  • Heterogens: UNL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vqzA (A:)
    mgsdkihhhhhhmkyiinhsndtafnialeeyafkhlldedqifllwinkpsiivgrhqn
    tieeinrdyvrengievvrrisgggavyhdlnnlnytiiskedenkafdfksfstpvint
    laqlgvkaeftgrndleidgkkfcgnaqayingrimhhgcllfdvdlsvlanalkvskdk
    feskgvksvrarvtniinelpkkitvekfrdllleymkkeypemteyvfseeelaeinri
    kdtkfgtwdwnygkspefnvrrgikftsgkvevfanvteskiqdikiygdffgiedvaav
    edvlrgvkyeredvlkalktiditryfagisreeiaeavvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqzA (A:)
    hmkyiinhsndtafnialeeyafkhlldedqifllwinkpsiivgrhqntieeinrdyvr
    engievvrrisgggavyhdlnnlnytiiskedenkafdfksfstpvintlaqlgvkaeft
    grndleidgkkfcgnaqayingrimhhgcllfdvdlsvlanalkvskdkfeskgvksvra
    rvtniinelpkkitvekfrdllleymkkeypemteyvfseeelaeinrikdtkfgtwdwn
    ygkspefnvrrgikftsgkvevfanvteskiqdikiygdffgiedvaavedvlrgvkyer
    edvlkalktiditryfagisreeiaeavvg