PDB entry 1vqy

View 1vqy on RCSB PDB site
Description: Crystal structure of a NIPSNAP family protein with unknown function (np_396154.1) from Agrobacterium tumefaciens at 2.40 A resolution
Class: structural genomics, unknown function
Keywords: np_396154.1, HYPOTHETICAL PROTEIN, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI
Deposited on 2005-01-07, released 2005-01-18
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.189
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein AGR_pAT_315
    Species: Agrobacterium tumefaciens
    Gene: AGR_pAT_315
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UK99 (12-115)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (26)
      • modified residue (65)
    Domains in SCOP 1.73: d1vqya1
  • Chain 'B':
    Compound: hypothetical protein AGR_pAT_315
    Species: Agrobacterium tumefaciens
    Gene: AGR_pAT_315
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UK99 (12-115)
      • leader sequence (2-11)
      • modified residue (12)
      • modified residue (26)
      • modified residue (65)
    Domains in SCOP 1.73: d1vqyb1
  • Chain 'C':
    Compound: hypothetical protein AGR_pAT_315
    Species: Agrobacterium tumefaciens
    Gene: AGR_pAT_315
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UK99 (12-115)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (26)
      • modified residue (65)
    Domains in SCOP 1.73: d1vqyc1
  • Chain 'D':
    Compound: hypothetical protein AGR_pAT_315
    Species: Agrobacterium tumefaciens
    Gene: AGR_pAT_315
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UK99 (12-115)
      • modified residue (12)
      • modified residue (26)
      • modified residue (65)
    Domains in SCOP 1.73: d1vqyd1
  • Chain 'E':
    Compound: hypothetical protein AGR_pAT_315
    Species: Agrobacterium tumefaciens
    Gene: AGR_pAT_315
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UK99 (12-115)
      • modified residue (12)
      • modified residue (26)
      • modified residue (65)
    Domains in SCOP 1.73: d1vqye1
  • Chain 'F':
    Compound: hypothetical protein AGR_pAT_315
    Species: Agrobacterium tumefaciens
    Gene: AGR_pAT_315
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UK99 (12-115)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (26)
      • modified residue (65)
    Domains in SCOP 1.73: d1vqyf1
  • Chain 'G':
    Compound: hypothetical protein AGR_pAT_315
    Species: Agrobacterium tumefaciens
    Gene: AGR_pAT_315
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UK99 (12-115)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (26)
      • modified residue (65)
    Domains in SCOP 1.73: d1vqyg1
  • Chain 'H':
    Compound: hypothetical protein AGR_pAT_315
    Species: Agrobacterium tumefaciens
    Gene: AGR_pAT_315
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UK99 (12-115)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (26)
      • modified residue (65)
    Domains in SCOP 1.73: d1vqyh1
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vqyA (A:)
    mgsdkihhhhhhmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigpl
    sqvihmwgyaslddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqyA (A:)
    hmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyas
    lddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vqyB (B:)
    mgsdkihhhhhhmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigpl
    sqvihmwgyaslddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqyB (B:)
    sdkihhhhhhmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsq
    vihmwgyaslddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vqyC (C:)
    mgsdkihhhhhhmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigpl
    sqvihmwgyaslddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqyC (C:)
    hmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyas
    lddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vqyD (D:)
    mgsdkihhhhhhmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigpl
    sqvihmwgyaslddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqyD (D:)
    miveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyasl
    ddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vqyE (E:)
    mgsdkihhhhhhmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigpl
    sqvihmwgyaslddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqyE (E:)
    miveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyasl
    ddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vqyF (F:)
    mgsdkihhhhhhmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigpl
    sqvihmwgyaslddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqyF (F:)
    hmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyas
    lddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1vqyG (G:)
    mgsdkihhhhhhmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigpl
    sqvihmwgyaslddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqyG (G:)
    hmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyas
    lddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1vqyH (H:)
    mgsdkihhhhhhmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigpl
    sqvihmwgyaslddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqyH (H:)
    hmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyas
    lddraerrgklaedqrwqafiprlsvliessenrillptdfsplr