PDB entry 1vqv

View 1vqv on RCSB PDB site
Description: Crystal Structure of Thiamine Monophosphate Kinase (thil) from Aquifex Aeolicus
Class: transferase
Keywords: THIL, KINASE, DIMER, PHOSPHATE, New York Structural GenomiX Research Consortium, NYSGXRC, PROTEIN STRUCTURE INITIATIVE, PSI, T1881, Structural Genomics
Deposited on 2005-01-05, released 2005-01-11
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.238
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiamine monophosphate kinase
    Species: Aquifex aeolicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67883 (0-End)
      • modified residue (0)
      • modified residue (168)
      • modified residue (205)
      • modified residue (241)
      • modified residue (278)
    Domains in SCOP 1.73: d1vqva1, d1vqva2
  • Chain 'B':
    Compound: Thiamine monophosphate kinase
    Species: Aquifex aeolicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67883 (0-End)
      • modified residue (0)
      • modified residue (168)
      • modified residue (205)
      • modified residue (241)
      • modified residue (278)
    Domains in SCOP 1.73: d1vqvb1, d1vqvb2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vqvA (A:)
    mrlkelgefglidlikktleskvigddtapveycskklllttdvlnegvhflrsyipeav
    gwkaisvnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggni
    sksekigisvflvgeterfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfela
    liqrhlrptaridyvkhiqkyanasmdisdglvadanhlaqrsgvkieilseklplsnel
    kmycekygknpieyalfggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvep
    kgwkhf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqvA (A:)
    mrlkelglidlikktleskviddtapvskklllttdvlnegvhflrsyipeavgwkaisv
    nvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggnisksekig
    isvflvgeterfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrhlr
    ptaridyvkhiqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmyceky
    gknpieyalfggedyqllfthpkerwnpfldmteigrveeggvfvdgkkvep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vqvB (B:)
    mrlkelgefglidlikktleskvigddtapveycskklllttdvlnegvhflrsyipeav
    gwkaisvnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggni
    sksekigisvflvgeterfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfela
    liqrhlrptaridyvkhiqkyanasmdisdglvadanhlaqrsgvkieilseklplsnel
    kmycekygknpieyalfggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvep
    kgwkhf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqvB (B:)
    mrlkelgefglidlikktleskviddtapveklllttdvlnegvhflrsyipeavgwkai
    svnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggnisksek
    igisvflvgeterfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrh
    lrptaridyvkhiqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmyce
    kygknpieyalfggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvep