PDB entry 1vqv

View 1vqv on RCSB PDB site
Description: crystal structure of thiamine monophosphate kinase (thil) from aquifex aeolicus
Deposited on 2005-01-05, released 2005-01-11
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-11, with a file datestamp of 2005-01-11.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.238
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vqvA (A:)
    mrlkelgefglidlikktleskvigddtapveycskklllttdvlnegvhflrsyipeav
    gwkaisvnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggni
    sksekigisvflvgeterfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfela
    liqrhlrptaridyvkhiqkyanasmdisdglvadanhlaqrsgvkieilseklplsnel
    kmycekygknpieyalfggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvep
    kgwkhf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqvA (A:)
    mrlkelglidlikktleskviddtapvskklllttdvlnegvhflrsyipeavgwkaisv
    nvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggnisksekig
    isvflvgeterfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrhlr
    ptaridyvkhiqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmyceky
    gknpieyalfggedyqllfthpkerwnpfldmteigrveeggvfvdgkkvep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vqvB (B:)
    mrlkelgefglidlikktleskvigddtapveycskklllttdvlnegvhflrsyipeav
    gwkaisvnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggni
    sksekigisvflvgeterfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfela
    liqrhlrptaridyvkhiqkyanasmdisdglvadanhlaqrsgvkieilseklplsnel
    kmycekygknpieyalfggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvep
    kgwkhf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqvB (B:)
    mrlkelgefglidlikktleskviddtapveklllttdvlnegvhflrsyipeavgwkai
    svnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggnisksek
    igisvflvgeterfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrh
    lrptaridyvkhiqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmyce
    kygknpieyalfggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvep