PDB entry 1vqu

View 1vqu on RCSB PDB site
Description: Crystal structure of Anthranilate phosphoribosyltransferase 2 (17130499) from Nostoc sp. at 1.85 A resolution
Deposited on 2005-01-05, released 2005-01-18
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.181
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anthranilate phosphoribosyltransferase 2
    Species: Nostoc sp. [TaxId:103690]
    Gene: trpD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YXQ9 (Start-373)
      • modified residue (48)
      • modified residue (81)
      • modified residue (91)
  • Chain 'B':
    Compound: Anthranilate phosphoribosyltransferase 2
    Species: Nostoc sp. [TaxId:103690]
    Gene: trpD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YXQ9 (Start-373)
      • modified residue (48)
      • modified residue (81)
      • modified residue (91)
  • Heterogens: ACT, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1vquA (A:)
    mgsdkihhhhhhmtssptstqesstswylllqqlidgeslsrsqaaelmqgwlseavppe
    lsgailtalnfkgvsadeltgmaevlqsqskmgtgenysqlpitnspfsiidtcgtggdg
    sstfnistavafvaaaygvpvakhgnrsassltgsadvlealgvnlgaspekvqaalqev
    gitflfapgwhpalkavatlrrtlrirtvfnllgplvnplrptgqvvglftpkllttvaq
    aldnlgkqkaivlhgrerldeaglgdltdlavlsdgelqlttinpqevgvtpapigalrg
    gdvqenaeilkavlqgkgtqaqqdavalnaalalqvagavplldhaqgvsvakeilqtgt
    awaklaqlvyflgn
    

    Sequence, based on observed residues (ATOM records):
    >1vquA (A:)
    tswylllqqlidgeslsrsqaaelmqgwlseavppelsgailtalnfkgvsadeltgmae
    vlqsqskmtnspfsiidtcgtgsstfnistavafvaaaygvpvakhgnrssltgsadvle
    algvnlgaspekvqaalqevgitflfapgwhpalkavatlrrtlrirtvfnllgplvnpl
    rptgqvvglftpkllttvaqaldnlgkqkaivlhgrerldeaglgdltdlavlsdgelql
    ttinpqevgvtpapigalrggdvqenaeilkavlqgkgtqaqqdavalnaalalqvagav
    plldhaqgvsvakeilqtgtawaklaqlvyflgn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1vquB (B:)
    mgsdkihhhhhhmtssptstqesstswylllqqlidgeslsrsqaaelmqgwlseavppe
    lsgailtalnfkgvsadeltgmaevlqsqskmgtgenysqlpitnspfsiidtcgtggdg
    sstfnistavafvaaaygvpvakhgnrsassltgsadvlealgvnlgaspekvqaalqev
    gitflfapgwhpalkavatlrrtlrirtvfnllgplvnplrptgqvvglftpkllttvaq
    aldnlgkqkaivlhgrerldeaglgdltdlavlsdgelqlttinpqevgvtpapigalrg
    gdvqenaeilkavlqgkgtqaqqdavalnaalalqvagavplldhaqgvsvakeilqtgt
    awaklaqlvyflgn
    

    Sequence, based on observed residues (ATOM records):
    >1vquB (B:)
    swylllqqlidgeslsrsqaaelmqgwlseavppelsgailtalnfkgvsadeltgmaev
    lqsqskmnspfsiidtcgtgsstfnistavafvaaaygvpvakhgnrsasltgsadvlea
    lgvnlgaspekvqaalqevgitflfappalkavatlrrtlrirtvfnllgplvnplrptg
    qvvglftpkllttvaqaldnlgkqkaivlhgrerldeaglgdltdlavlsdgelqlttin
    pqevgvtpapigalrggdvqenaeilkavlqgkgtqaqqdavalnaalalqvagavplld
    haqgvsvakeilqtgtawaklaqlvyflgn