PDB entry 1vqt

View 1vqt on RCSB PDB site
Description: Crystal structure of Orotidine 5'-phosphate decarboxylase (TM0332) from Thermotoga maritima at 2.00 A resolution
Class: lyase
Keywords: TM0332, Orotidine 5'-phosphate decarboxylase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, LYASE
Deposited on 2005-01-04, released 2005-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: pyrF, TM0332
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYG7 (12-End)
      • leader sequence (10-11)
    Domains in SCOPe 2.06: d1vqta1, d1vqta2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vqtA (A:)
    mgsdkihhhhhhmtpvlsldmedpirfidengsfevvkvghnlaihgkkifdelakrnlk
    iildlkfcdipstversikswdhpaiigftvhscagyesveralsatdkhvfvvvkltsm
    egsledymdrieklnklgcdfvlpgpwakalrekikgkilvpgirmevkaddqkdvvtle
    emkgianfavlgreiylsenprekikrikemrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqtA (A:)
    hhmtpvlsldmedpirfidengsfevvkvghnlaihgkkifdelakrnlkiildlkfcdi
    pstversikswdhpaiigftvhscagyesveralsatdkhvfvvvkltsmegsledymdr
    ieklnklgcdfvlpgpwakalrekikgkilvpgirdvvtleemkgianfavlgreiylse
    nprekikrike