PDB entry 1vqs

View 1vqs on RCSB PDB site
Description: Crystal structure of a nipsnap family protein with unknown function (atu4242) from agrobacterium tumefaciens str. c58 at 1.50 A resolution
Class: unknown function
Keywords: Ferredoxin-like fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, unknown function
Deposited on 2004-12-20, released 2005-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.152
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein AGR_L_1239
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: np_356412.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U857 (12-115)
      • leader sequence (6-11)
      • modified residue (12)
      • modified residue (82)
      • modified residue (106)
      • modified residue (115)
    Domains in SCOPe 2.07: d1vqsa1, d1vqsa2
  • Chain 'B':
    Compound: hypothetical protein AGR_L_1239
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: np_356412.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U857 (12-115)
      • leader sequence (5-11)
      • modified residue (12)
      • modified residue (82)
      • modified residue (106)
      • modified residue (115)
    Domains in SCOPe 2.07: d1vqsb1, d1vqsb2
  • Chain 'C':
    Compound: hypothetical protein AGR_L_1239
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: np_356412.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U857 (12-115)
      • leader sequence (6-11)
      • modified residue (12)
      • modified residue (82)
      • modified residue (106)
      • modified residue (115)
    Domains in SCOPe 2.07: d1vqsc1, d1vqsc2
  • Chain 'D':
    Compound: hypothetical protein AGR_L_1239
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: np_356412.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U857 (12-115)
      • leader sequence (6-11)
      • modified residue (12)
      • modified residue (82)
      • modified residue (106)
      • modified residue (115)
    Domains in SCOPe 2.07: d1vqsd1, d1vqsd2
  • Chain 'E':
    Compound: hypothetical protein AGR_L_1239
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: np_356412.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U857 (12-115)
      • leader sequence (6-11)
      • modified residue (12)
      • modified residue (82)
      • modified residue (106)
      • modified residue (115)
    Domains in SCOPe 2.07: d1vqse1, d1vqse2
  • Heterogens: SO4, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vqsA (A:)
    mgsdkihhhhhhmfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpi
    neivhiwafsslddraerrarlmadprwlsflpkirdlievaenkimkparfsplm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqsA (A:)
    hhhhhhmfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhi
    wafsslddraerrarlmadprwlsflpkirdlievaenkimkparfsplm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vqsB (B:)
    mgsdkihhhhhhmfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpi
    neivhiwafsslddraerrarlmadprwlsflpkirdlievaenkimkparfsplm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqsB (B:)
    ihhhhhhmfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivh
    iwafsslddraerrarlmadprwlsflpkirdlievaenkimkparfsplm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vqsC (C:)
    mgsdkihhhhhhmfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpi
    neivhiwafsslddraerrarlmadprwlsflpkirdlievaenkimkparfsplm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqsC (C:)
    hhhhhhmfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhi
    wafsslddraerrarlmadprwlsflpkirdlievaenkimkparfsplm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vqsD (D:)
    mgsdkihhhhhhmfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpi
    neivhiwafsslddraerrarlmadprwlsflpkirdlievaenkimkparfsplm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqsD (D:)
    hhhhhhmfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhi
    wafsslddraerrarlmadprwlsflpkirdlievaenkimkparfsplm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vqsE (E:)
    mgsdkihhhhhhmfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpi
    neivhiwafsslddraerrarlmadprwlsflpkirdlievaenkimkparfsplm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqsE (E:)
    hhhhhhmfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhi
    wafsslddraerrarlmadprwlsflpkirdlievaenkimkparfsplm