PDB entry 1vqr

View 1vqr on RCSB PDB site
Description: Crystal structure of a virulence factor (cj0248) from campylobacter jejuni subsp. jejuni at 2.25 A resolution
Class: unknown function
Keywords: Hd-domain/pdease-like fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, unknown function
Deposited on 2004-12-17, released 2004-12-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.195
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein Cj0248
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj0248
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PIP7 (12-296)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (16)
      • modified residue (51)
      • modified residue (63)
      • modified residue (102)
      • modified residue (155)
    Domains in SCOPe 2.06: d1vqra1, d1vqra2
  • Chain 'B':
    Compound: hypothetical protein Cj0248
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj0248
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PIP7
      • modified residue (16)
      • modified residue (51)
      • modified residue (63)
      • modified residue (102)
      • modified residue (155)
    Domains in SCOPe 2.06: d1vqrb_
  • Chain 'C':
    Compound: hypothetical protein Cj0248
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj0248
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PIP7 (12-End)
      • modified residue (12)
      • modified residue (16)
      • modified residue (51)
      • modified residue (63)
      • modified residue (102)
      • modified residue (155)
    Domains in SCOPe 2.06: d1vqrc_
  • Chain 'D':
    Compound: hypothetical protein Cj0248
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj0248
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PIP7
      • modified residue (16)
      • modified residue (51)
      • modified residue (63)
      • modified residue (102)
      • modified residue (155)
    Domains in SCOPe 2.06: d1vqrd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vqrA (A:)
    mgsdkihhhhhhmigdmnelllksvevlpplpdtvsklrkyvseansnietmkvaeiiss
    dplmtakllqlanspyygftreittinqvitllgvgniinivmadsirdnfkidvspygl
    ntqnflktcneeatfianwlndedkklshllvpcamllrlgivifsnfliqnhkdkdfla
    flnknenlalaeneflgvdhisflgfllhrwnfddvliesicfvrtphaarekvkksaya
    laitdhlfaphdgsspfnakaavallkeaktqginfdlnnllsklpnkakenlnked
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqrA (A:)
    hmigdmnelllksvevlpplpdtvsklrkyvseanietmkvaeiissdplmtakllqlan
    spyygftreittinqvitllgvgniinivmadsirdnfkidvspyglntqnflktcneea
    tfianwlndedkklshllvpcamllrlgivifsnfliqnhkdkdflaflnknenlalaen
    eflgvdhisflgfllhrwnfddvliesicfvrtphaarekvkksayalaitdhlfaphdg
    sspfnakaavallkeaktqginfdlnnllsklpnkakenlnked
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vqrB (B:)
    mgsdkihhhhhhmigdmnelllksvevlpplpdtvsklrkyvseansnietmkvaeiiss
    dplmtakllqlanspyygftreittinqvitllgvgniinivmadsirdnfkidvspygl
    ntqnflktcneeatfianwlndedkklshllvpcamllrlgivifsnfliqnhkdkdfla
    flnknenlalaeneflgvdhisflgfllhrwnfddvliesicfvrtphaarekvkksaya
    laitdhlfaphdgsspfnakaavallkeaktqginfdlnnllsklpnkakenlnked
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqrB (B:)
    mnelllksvevlpplpdtvsklrkyvseietmkvaeiissdplmtakllqlanspyygft
    reittinqvitllgvgniinivmadnfkidvspyglntqnflktcneeatfianwlnded
    kklshllvpcamllrlgivifsnfliqnhkdkdflaflnknenlalaeneflgvdhisfl
    gfllhrwnfddvliesicfvrtphaarekvkksayalaitdhlfaphdgsspfnakaava
    llkeaktqginfdlnnllsklpnkakenl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vqrC (C:)
    mgsdkihhhhhhmigdmnelllksvevlpplpdtvsklrkyvseansnietmkvaeiiss
    dplmtakllqlanspyygftreittinqvitllgvgniinivmadsirdnfkidvspygl
    ntqnflktcneeatfianwlndedkklshllvpcamllrlgivifsnfliqnhkdkdfla
    flnknenlalaeneflgvdhisflgfllhrwnfddvliesicfvrtphaarekvkksaya
    laitdhlfaphdgsspfnakaavallkeaktqginfdlnnllsklpnkakenlnked
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqrC (C:)
    migdmnelllksvevlpplpdtvsklrkyvseansnietmkvaeiissdplmtakllqla
    nspyygftreittinqvitllgvgniinivmadsirdnfkidvspyglntqnflktcnee
    atfianwlndedkklshllvpcamllrlgivifsnfliqnhkdkdflaflnknenlalae
    neflgvdhisflgfllhrwnfddvliesicfvrtphaarekvkksayalaitdhlfaphd
    gsspfnakaavallkeaktqginfdlnnllsklpnkakenl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vqrD (D:)
    mgsdkihhhhhhmigdmnelllksvevlpplpdtvsklrkyvseansnietmkvaeiiss
    dplmtakllqlanspyygftreittinqvitllgvgniinivmadsirdnfkidvspygl
    ntqnflktcneeatfianwlndedkklshllvpcamllrlgivifsnfliqnhkdkdfla
    flnknenlalaeneflgvdhisflgfllhrwnfddvliesicfvrtphaarekvkksaya
    laitdhlfaphdgsspfnakaavallkeaktqginfdlnnllsklpnkakenlnked
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqrD (D:)
    mnelllksvevlpplpdtvsklrkyvietmkvaeiissdplmtakllqlanspyygftre
    ittinqvitllgvgniinivmadnfkidvspyglntqnflktcneeatfianwlndedkk
    lshllvpcamllrlgivifsnfliqnhkdkdflaflnknenlalaeneflgvdhisflgf
    llhrwnfddvliesicfvrtphaarekvkksayalaitdhlfaphdgsspfnakaavall
    keaktqginfdlnnllsklpnkakenl