PDB entry 1vqq

View 1vqq on RCSB PDB site
Description: Structure of Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r at 1.80 A resolution.
Class: biosynthetic protein
Keywords: penicillin binding protein, beta-lactam, d, d-transpeptidase, d-carboxypeptidase, BIOSYNTHETIC PROTEIN
Deposited on 2004-12-17, released 2004-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.237
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin-binding protein mecA, low-affinity
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mecA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vqqa1, d1vqqa2, d1vqqa3
  • Chain 'B':
    Compound: penicillin-binding protein mecA, low-affinity
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mecA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vqqb1, d1vqqb2, d1vqqb3
  • Heterogens: CD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vqqA (A:)
    maskdkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqd
    rkikkvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsi
    hienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmd
    qnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgpinse
    elkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgk
    diqltidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynk
    ltedkkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggyn
    vtryevvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaq
    isnknldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkni
    iskeninlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydk
    dnpnmmmainvkdvqdkgmasynakisgkvydelyengnkkydide
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqqA (A:)
    dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
    kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihien
    lksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqnwv
    qddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgpinseelkq
    keykgykddavigkkgleklydkklqhedgyrvtivddsntiahtliekkkkdgkdiqlt
    idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk
    kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye
    vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn
    ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken
    inlltdgmqqvvnkthkediyrsyanligksgtaelkgrqigwfisydkdnpnmmmainv
    kdvqdkgmasynakisgkvydelyengnkkydide
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vqqB (B:)
    maskdkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqd
    rkikkvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsi
    hienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmd
    qnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgpinse
    elkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgk
    diqltidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynk
    ltedkkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggyn
    vtryevvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaq
    isnknldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkni
    iskeninlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydk
    dnpnmmmainvkdvqdkgmasynakisgkvydelyengnkkydide
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqqB (B:)
    dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
    krvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihienlkserg
    kildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqnwvqddtfv
    plktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgpinseelkqkeykgy
    kddavigkkgleklydkklqhedgyrvtivddsntiahtliekkkkdgkdiqltidakvq
    ksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedkkeplln
    kfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtryevvngni
    dlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqildneillads
    gygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniiskeninlltdgmqq
    vvnkthkediyrsyanligksgtaelkgrqigwfisydkdnpnmmmainvkdvqdkgmas
    ynakisgkvydelyengnkkydide