PDB entry 1vqd

View 1vqd on RCSB PDB site
Description: gene v protein mutant with val 35 replaced by ile 35 and ile 47 replaced by leu 47 (v35i, i47l)
Class: DNA-binding protein
Keywords: DNA-binding protein, gene v, mutant
Deposited on 1996-08-14, released 1997-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.21
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gene v protein
    Species: Enterobacteria phage f1 [TaxId:10863]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69543 (0-End)
      • engineered (34)
      • engineered (46)
    Domains in SCOPe 2.08: d1vqda_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1vqdA (A:)
mikveikpsqaqfttrsgvsrqgkpyslneqlcyidlgneypvlvkltldegqpayapgl
ytvhlssfkvgqfgslmidrlrlvpak

    Sequence, based on observed residues (ATOM records): (download) 
    >1vqdA (A:)
mikveikpsqaqfttrsgvsrqgkpyslneqlcyidlgneypvlvkltldegqpayapgl
ytvhlssfkvgqfgslmidrlrlvpa