PDB entry 1vq2

View 1vq2 on RCSB PDB site
Description: crystal structure of t4-bacteriophage deoxycytidylate deaminase, mutant r115e
Class: hydrolase
Keywords: hydrolase
Deposited on 2004-12-15, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxycytidylate deaminase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: CD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16006 (0-192)
      • engineered (114)
    Domains in SCOPe 2.07: d1vq2a_
  • Heterogens: ZN, DDN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vq2A (A:)
    mkastvlqiaylvsqeskccswkvgaviekngriistgyngspaggvnccdyaaeqgwll
    nkpkhaiiqghkpecvsfgstdrfvlakehrsahsewsskneihaelnailfaaengssi
    egatmyvtlspcpdcakaiaqsgikklvycetydknkpgwddilrnagievfnvpkknln
    klnweninefcge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vq2A (A:)
    mkastvlqiaylvsqeskccswkvgaviekngriistgyngspaggvnccdyaaeqgwll
    nkrfvlakehrsahsewsskneihaelnailfaaengssiegatmyvtlspcpdcakaia
    qsgikklvycetydknkpgwddilrnagievfnvpkknlnklnweninefcge