PDB entry 1vq1

View 1vq1 on RCSB PDB site
Description: Crystal structure of N5-glutamine methyltransferase, HemK(EC 2.1.1.-) (TM0488) from Thermotoga maritima at 2.80 A resolution
Class: transferase
Keywords: TM0488, N5-glutamine methyltransferase, HEMK(EC 2.1.1.-), Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, TRANSFERASE
Deposited on 2004-12-02, released 2005-02-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.212
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N5-glutamine methyltransferase, HemK
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0488
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYV8 (Start-293)
      • modified residue (100)
      • modified residue (204)
      • modified residue (256)
    Domains in SCOPe 2.08: d1vq1a_
  • Chain 'B':
    Compound: N5-glutamine methyltransferase, HemK
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0488
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYV8 (Start-293)
      • modified residue (100)
      • modified residue (204)
      • modified residue (256)
    Domains in SCOPe 2.08: d1vq1b_
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vq1A (A:)
    mgsdkihhhhhhmdtrknvsgaerkiwslirdcsgklegvtetsvlevllivsrvlgirk
    edlflkdlgvspteekrilelvekrasgyplhyilgekefmglsflveegvfvprpetee
    lvelalelirkygiktvadigtgsgaigvsvakfsdaivfatdvsskaveiarknaerhg
    vsdrffvrkgeflepfkekfasiemilsnppyvkssahlpkdvlfeppealfggedgldf
    yreffgrydtsgkivlmeigedqveelkkivsdtvflkdsagkyrflllnrrss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vq1A (A:)
    rkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekrilelve
    krasgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvadigtg
    sgaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkekfasi
    emilsnppyvkssahlfeppealfggedgldfyreffgrydtsgkivlmeigedqveelk
    kivsdtvflkdsagkyrflllnrrss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vq1B (B:)
    mgsdkihhhhhhmdtrknvsgaerkiwslirdcsgklegvtetsvlevllivsrvlgirk
    edlflkdlgvspteekrilelvekrasgyplhyilgekefmglsflveegvfvprpetee
    lvelalelirkygiktvadigtgsgaigvsvakfsdaivfatdvsskaveiarknaerhg
    vsdrffvrkgeflepfkekfasiemilsnppyvkssahlpkdvlfeppealfggedgldf
    yreffgrydtsgkivlmeigedqveelkkivsdtvflkdsagkyrflllnrrss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vq1B (B:)
    rkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekrilelve
    krasgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvadigtg
    sgaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkekfasi
    emilsnppyvksslfeppealfggedgldfyreffgrydtsgkivlmeigedqveelkki
    vsdtvflkdsagkyrflllnrrss