PDB entry 1vpz

View 1vpz on RCSB PDB site
Description: crystal structure of a putative carbon storage regulator protein (csra, pa0905) from pseudomonas aeruginosa at 2.05 a resolution
Deposited on 2004-11-24, released 2004-12-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-14, with a file datestamp of 2004-12-14.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.221
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1vpza_
  • Chain 'B':
    Domains in SCOP 1.71: d1vpzb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vpzA (A:)
    mgsdkihhhhhhmliltrrvgetlmvgddvtvtvlgvkgnqvrigvnapkevavhreeiy
    qriqkekdqepnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpzA (A:)
    hhmliltrrvgetlmvgddvtvtvlgvkgnqvrigvnapkevavhreeiyqriqkek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vpzB (B:)
    mgsdkihhhhhhmliltrrvgetlmvgddvtvtvlgvkgnqvrigvnapkevavhreeiy
    qriqkekdqepnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpzB (B:)
    hhhmliltrrvgetlmvgddvtvtvlgvkgnqvrigvnapkevavhreeiyqriqk