PDB entry 1vpy

View 1vpy on RCSB PDB site
Description: CRYSTAL STRUCTURE OF a DUF72 family protein (EF0366) FROM ENTEROCOCCUS FAECALIS V583 AT 2.52 A RESOLUTION
Class: unknown function
Keywords: tim alpha/beta barrel fold, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, unknown function
Deposited on 2004-11-23, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PROTEIN (hypothetical protein EF0366)
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: ef0366
    Database cross-references and differences (RAF-indexed):
    • GB NP_814157 (12-End)
      • leader sequence (8-11)
      • modified residue (12)
      • modified residue (46)
      • modified residue (74)
      • modified residue (96)
      • modified residue (104)
      • modified residue (164)
      • modified residue (168)
      • modified residue (243)
      • modified residue (269)
    Domains in SCOPe 2.07: d1vpya1, d1vpya2
  • Heterogens: ZN, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vpyA (A:)
    mgsdkihhhhhhmirlgltsfsehdyltgkkrstlyeyashlplvemdtayygippkerv
    aewvkavpenfrfvmkvysgiscqgewqtyyaseeemitaflesmaplieskklfaflvq
    fsgtfgctkenvaylqkirhwfkdlpiaielrnnswyqpnfvkqmlqfmkenqfslvivd
    epqiptnpvpfypyvtnpnlvlfrfhgrnaagwlandaewrkkrtlyhyntqeiadlsea
    vlkmsqeakevgvifnnnsggdaaenalqmqkvlnlsyddlnpkqldlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpyA (A:)
    hhhhmirlgltsfsstlyeyashlplvemdtayygippkervaewvkavpenfrfvmkvy
    sgiscqgewqtyyaseeemitaflesmaplieskklfaflvqfsgtfgctkenvaylqki
    rhwfkdlpiaielrnnswyqpnfvkqmlqfmkenqfslvivdepqiptnpvpfypyvtnp
    nlvlfrfhgrnaagwkkrtlyhyntqeiadlseavlkmsqeakevgvifnnnsggdaaen
    alqmqkvlnls