PDB entry 1vpx

View 1vpx on RCSB PDB site
Description: Crystal structure of Transaldolase (EC 2.2.1.2) (TM0295) from Thermotoga maritima at 2.40 A resolution
Class: transferase
Keywords: TM0295, TRANSALDOLASE (EC 2.2.1.2), Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, TRANSFERASE
Deposited on 2004-11-23, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.199
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PROTEIN (Transaldolase (EC 2.2.1.2))
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0295
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYD1 (12-End)
      • leader sequence (10-11)
    Domains in SCOPe 2.07: d1vpxa1, d1vpxa2
  • Chain 'B':
    Compound: PROTEIN (Transaldolase (EC 2.2.1.2))
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0295
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYD1 (12-End)
      • leader sequence (10-11)
    Domains in SCOPe 2.07: d1vpxb1, d1vpxb2
  • Chain 'C':
    Compound: PROTEIN (Transaldolase (EC 2.2.1.2))
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0295
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYD1 (12-End)
      • leader sequence (11)
    Domains in SCOPe 2.07: d1vpxc1, d1vpxc2
  • Chain 'D':
    Compound: PROTEIN (Transaldolase (EC 2.2.1.2))
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0295
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYD1 (12-End)
      • leader sequence (10-11)
    Domains in SCOPe 2.07: d1vpxd1, d1vpxd2
  • Chain 'E':
    Compound: PROTEIN (Transaldolase (EC 2.2.1.2))
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0295
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYD1 (12-End)
      • leader sequence (11)
    Domains in SCOPe 2.07: d1vpxe1, d1vpxe2
  • Chain 'F':
    Compound: PROTEIN (Transaldolase (EC 2.2.1.2))
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0295
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYD1 (12-End)
      • leader sequence (10-11)
    Domains in SCOPe 2.07: d1vpxf1, d1vpxf2
  • Chain 'G':
    Compound: PROTEIN (Transaldolase (EC 2.2.1.2))
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0295
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYD1 (12-End)
      • leader sequence (10-11)
    Domains in SCOPe 2.07: d1vpxg1, d1vpxg2
  • Chain 'H':
    Compound: PROTEIN (Transaldolase (EC 2.2.1.2))
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0295
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYD1 (12-End)
      • leader sequence (11)
    Domains in SCOPe 2.07: d1vpxh1, d1vpxh2
  • Chain 'I':
    Compound: PROTEIN (Transaldolase (EC 2.2.1.2))
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0295
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYD1 (12-End)
      • leader sequence (10-11)
    Domains in SCOPe 2.07: d1vpxi1, d1vpxi2
  • Chain 'J':
    Compound: PROTEIN (Transaldolase (EC 2.2.1.2))
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0295
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYD1 (12-End)
      • leader sequence (10-11)
    Domains in SCOPe 2.07: d1vpxj1, d1vpxj2
  • Chain 'K':
    Compound: PROTEIN (Transaldolase (EC 2.2.1.2))
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0295
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYD1 (12-End)
      • leader sequence (11)
    Domains in SCOPe 2.07: d1vpxk1, d1vpxk2
  • Chain 'L':
    Compound: PROTEIN (Transaldolase (EC 2.2.1.2))
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0295
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYD1 (12-End)
      • leader sequence (10-11)
    Domains in SCOPe 2.07: d1vpxl1, d1vpxl2
  • Chain 'M':
    Compound: PROTEIN (Transaldolase (EC 2.2.1.2))
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0295
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYD1 (12-End)
      • leader sequence (11)
    Domains in SCOPe 2.07: d1vpxm1, d1vpxm2
  • Chain 'N':
    Compound: PROTEIN (Transaldolase (EC 2.2.1.2))
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0295
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYD1 (12-End)
      • leader sequence (11)
    Domains in SCOPe 2.07: d1vpxn1, d1vpxn2
  • Chain 'O':
    Compound: PROTEIN (Transaldolase (EC 2.2.1.2))
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0295
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYD1 (12-End)
      • leader sequence (10-11)
    Domains in SCOPe 2.07: d1vpxo1, d1vpxo2
  • Chain 'P':
    Compound: PROTEIN (Transaldolase (EC 2.2.1.2))
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0295
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYD1 (12-End)
      • leader sequence (10-11)
    Domains in SCOPe 2.07: d1vpxp1, d1vpxp2
  • Chain 'Q':
    Compound: PROTEIN (Transaldolase (EC 2.2.1.2))
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0295
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYD1 (12-End)
      • leader sequence (10-11)
    Domains in SCOPe 2.07: d1vpxq1, d1vpxq2
  • Chain 'R':
    Compound: PROTEIN (Transaldolase (EC 2.2.1.2))
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0295
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYD1 (12-End)
      • leader sequence (11)
    Domains in SCOPe 2.07: d1vpxr1, d1vpxr2
  • Chain 'S':
    Compound: PROTEIN (Transaldolase (EC 2.2.1.2))
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0295
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYD1 (12-End)
      • leader sequence (11)
    Domains in SCOPe 2.07: d1vpxs1, d1vpxs2
  • Chain 'T':
    Compound: PROTEIN (Transaldolase (EC 2.2.1.2))
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0295
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYD1 (12-End)
      • leader sequence (11)
    Domains in SCOPe 2.07: d1vpxt1, d1vpxt2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vpxA (A:)
    mgsdkihhhhhhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicd
    lvkgpvsaevvsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtl
    vfspaqailaakagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhp
    mhvveaalmgvdivtmpfavleklfkhpmtdlgierfmedwkkylenlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpxA (A:)
    hhmkifldtanleeikkgvewgivdgvttnpqrvkeicdlvkgpvsaevvsldyegmvre
    arelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaakagatyvspf
    vgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgvdivtmpfavl
    eklfkhpmtdlgierfmedwkkylenl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vpxB (B:)
    mgsdkihhhhhhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicd
    lvkgpvsaevvsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtl
    vfspaqailaakagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhp
    mhvveaalmgvdivtmpfavleklfkhpmtdlgierfmedwkkylenlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpxB (B:)
    hhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicdlvkgpvsaev
    vsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqaila
    akagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmg
    vdivtmpfavleklfkhpmtdlgierfme
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vpxC (C:)
    mgsdkihhhhhhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicd
    lvkgpvsaevvsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtl
    vfspaqailaakagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhp
    mhvveaalmgvdivtmpfavleklfkhpmtdlgierfmedwkkylenlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpxC (C:)
    hmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicdlvkgpvsaevv
    sldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaa
    kagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgv
    divtmpfavleklfkhpmtdlgierfme
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vpxD (D:)
    mgsdkihhhhhhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicd
    lvkgpvsaevvsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtl
    vfspaqailaakagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhp
    mhvveaalmgvdivtmpfavleklfkhpmtdlgierfmedwkkylenlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpxD (D:)
    hhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicdlvkgpvsaev
    vsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqaila
    akagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmg
    vdivtmpfavleklfkhpmtdlgierfmed
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vpxE (E:)
    mgsdkihhhhhhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicd
    lvkgpvsaevvsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtl
    vfspaqailaakagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhp
    mhvveaalmgvdivtmpfavleklfkhpmtdlgierfmedwkkylenlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpxE (E:)
    hmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicdlvkgpvsaevv
    sldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaa
    kagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgv
    divtmpfavleklfkhpmtdlgierfmedwkkylen
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vpxF (F:)
    mgsdkihhhhhhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicd
    lvkgpvsaevvsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtl
    vfspaqailaakagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhp
    mhvveaalmgvdivtmpfavleklfkhpmtdlgierfmedwkkylenlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpxF (F:)
    hhmkifldtanleeikkgvewgivdgvttnptlaefkqrvkeicdlvkgpvsaevvsldy
    egmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaakaga
    tyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgvdivt
    mpfavleklfkhpmtdlgierfmedwkkylenl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1vpxG (G:)
    mgsdkihhhhhhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicd
    lvkgpvsaevvsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtl
    vfspaqailaakagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhp
    mhvveaalmgvdivtmpfavleklfkhpmtdlgierfmedwkkylenlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpxG (G:)
    hhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicdlvkgpvsaev
    vsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqaila
    akagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmg
    vdivtmpfavleklfkhpmtdlgierfmedwkkyle
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1vpxH (H:)
    mgsdkihhhhhhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicd
    lvkgpvsaevvsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtl
    vfspaqailaakagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhp
    mhvveaalmgvdivtmpfavleklfkhpmtdlgierfmedwkkylenlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpxH (H:)
    hmkifldtanleeikkgvewgivdgvttnptliskfkqrvkeicdlvkgpvsaevvsldy
    egmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaakaga
    tyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgvdivt
    mpfavleklfkhpmtdlgierfmed
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1vpxI (I:)
    mgsdkihhhhhhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicd
    lvkgpvsaevvsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtl
    vfspaqailaakagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhp
    mhvveaalmgvdivtmpfavleklfkhpmtdlgierfmedwkkylenlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpxI (I:)
    hhmkifldtanleeikkgvewgivdgvttnptlisfkqrvkeicdlvkgpvsaevvsldy
    egmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaakaga
    tyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgvdivt
    mpfavleklfkhpmtdlgierfmedwkkyle
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1vpxJ (J:)
    mgsdkihhhhhhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicd
    lvkgpvsaevvsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtl
    vfspaqailaakagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhp
    mhvveaalmgvdivtmpfavleklfkhpmtdlgierfmedwkkylenlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpxJ (J:)
    hhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicdlvkgpvsaev
    vsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqaila
    akagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmg
    vdivtmpfavleklfkhpmtdlgierfmedwkk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1vpxK (K:)
    mgsdkihhhhhhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicd
    lvkgpvsaevvsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtl
    vfspaqailaakagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhp
    mhvveaalmgvdivtmpfavleklfkhpmtdlgierfmedwkkylenlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpxK (K:)
    hmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicdlvkgpvsaevv
    sldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaa
    kagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgv
    divtmpfavleklfkhpmtdlgierfmedwkkylen
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1vpxL (L:)
    mgsdkihhhhhhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicd
    lvkgpvsaevvsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtl
    vfspaqailaakagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhp
    mhvveaalmgvdivtmpfavleklfkhpmtdlgierfmedwkkylenlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpxL (L:)
    hhmkifldtanleeikkgvewgivdgvttnptlifkqrvkeicdlvkgpvsaevvsldye
    gmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaakagat
    yvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgvdivtm
    pfavleklfkhpmtdlgierfmed
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1vpxM (M:)
    mgsdkihhhhhhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicd
    lvkgpvsaevvsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtl
    vfspaqailaakagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhp
    mhvveaalmgvdivtmpfavleklfkhpmtdlgierfmedwkkylenlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpxM (M:)
    hmkifldtanleeikkgvewgivdgvttnptliskrvkeicdlvkgpvsaevvsldyegm
    vrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaakagatyv
    spfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgvdivtmpf
    avleklfkhpmtdlgier
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1vpxN (N:)
    mgsdkihhhhhhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicd
    lvkgpvsaevvsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtl
    vfspaqailaakagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhp
    mhvveaalmgvdivtmpfavleklfkhpmtdlgierfmedwkkylenlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpxN (N:)
    hmkifldtanleeikkgvewgivdgvttnptliskefkqrvkeicdlvkgpvsaevvsld
    yegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaakag
    atyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgvdiv
    tmpfavleklfkhpmtdlgierfm
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1vpxO (O:)
    mgsdkihhhhhhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicd
    lvkgpvsaevvsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtl
    vfspaqailaakagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhp
    mhvveaalmgvdivtmpfavleklfkhpmtdlgierfmedwkkylenlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpxO (O:)
    hhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicdlvkgpvsaev
    vsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqaila
    akagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmg
    vdivtmpfavleklfkhpmtdlgierfmed
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1vpxP (P:)
    mgsdkihhhhhhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicd
    lvkgpvsaevvsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtl
    vfspaqailaakagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhp
    mhvveaalmgvdivtmpfavleklfkhpmtdlgierfmedwkkylenlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpxP (P:)
    hhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicdlvkgpvsaev
    vsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqaila
    akagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmg
    vdivtmpfavleklfkhpmtdlgierfme
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1vpxQ (Q:)
    mgsdkihhhhhhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicd
    lvkgpvsaevvsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtl
    vfspaqailaakagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhp
    mhvveaalmgvdivtmpfavleklfkhpmtdlgierfmedwkkylenlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpxQ (Q:)
    hhmkifldtanleeikkgvewgivdgvttnaefkqrvkeicdlvkgpvsaevvsldyegm
    vrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaakagatyv
    spfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgvdivtmpf
    avleklfkhpmtdlgierfmedwkkyle
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1vpxR (R:)
    mgsdkihhhhhhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicd
    lvkgpvsaevvsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtl
    vfspaqailaakagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhp
    mhvveaalmgvdivtmpfavleklfkhpmtdlgierfmedwkkylenlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpxR (R:)
    hmkifldtanleeikkgvewgivdgvttnptaefkqrvkeicdlvkgpvsaevvsldyeg
    mvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaakagaty
    vspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgvdivtmp
    favleklfkhpmtdlgierfmedwkkylen
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1vpxS (S:)
    mgsdkihhhhhhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicd
    lvkgpvsaevvsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtl
    vfspaqailaakagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhp
    mhvveaalmgvdivtmpfavleklfkhpmtdlgierfmedwkkylenlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpxS (S:)
    hmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicdlvkgpvsaevv
    sldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaa
    kagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgv
    divtmpfavleklfkhpmtdlgier
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1vpxT (T:)
    mgsdkihhhhhhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicd
    lvkgpvsaevvsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtl
    vfspaqailaakagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhp
    mhvveaalmgvdivtmpfavleklfkhpmtdlgierfmedwkkylenlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpxT (T:)
    hmkifldtanleeikkgvewgivdgvttnptvkeicdlvkgpvsaevvsldyegmvrear
    elaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaakagatyvspfvg
    rmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgvdivtmpfavlek
    lfkhpmtdlgierfmedwkkylen