PDB entry 1vpv

View 1vpv on RCSB PDB site
Description: Crystal structure of a degv lipid binding protein (tm1468) from thermotoga maritima at 2.45 A resolution
Class: lipid binding protein
Keywords: Dak1/degv-like fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, lipid binding protein
Deposited on 2004-11-18, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.184
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0230 protein TM1468
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1468
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1H9 (12-End)
      • modified residue (12)
      • modified residue (29)
      • modified residue (59)
      • modified residue (146)
      • modified residue (164)
      • modified residue (275)
    Domains in SCOPe 2.07: d1vpva_
  • Chain 'B':
    Compound: UPF0230 protein TM1468
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1468
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1H9 (12-End)
      • modified residue (12)
      • modified residue (29)
      • modified residue (59)
      • modified residue (146)
      • modified residue (164)
      • modified residue (275)
    Domains in SCOPe 2.07: d1vpvb_
  • Heterogens: PO4, PLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vpvA (A:)
    mgsdkihhhhhhmkvkilvdstadvpfswmekydidsiplyvvwedgrsepderepeeim
    nfykrireagsvpktsqpsvedfkkrylkykeedydvvlvltlssklsgtynsavlaske
    vdipvyvvdtllasgaiplparvaremlengatieevlkkldermknkdfkaifyvsnfd
    ylvkggrvskfqgfvgnllkirvclhiengelipyrkvrgdkkaiealieklredtpegs
    klrvigvhadneagvvellntlrksyevvdeiispmgkvitthvgpgtvgfgievlerkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpvA (A:)
    mkvkilvdstadvpfswmekydidsiplyvvwedgrsepderepeeimnfykrireagsv
    pktsqpsvedfkkrylkykeedydvvlvltlssklsgtynsavlaskevdipvyvvdtll
    asgaiplparvaremlengatieevlkkldermknkdfkaifyvsnfdylvkggrvfvgn
    llkirvclhiengelipyrkvrgdkkaiealieklredtpegsklrvigvhadneagvve
    llntlrksyevvdeiispmgkvitthvgpgtvgfgievlerk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vpvB (B:)
    mgsdkihhhhhhmkvkilvdstadvpfswmekydidsiplyvvwedgrsepderepeeim
    nfykrireagsvpktsqpsvedfkkrylkykeedydvvlvltlssklsgtynsavlaske
    vdipvyvvdtllasgaiplparvaremlengatieevlkkldermknkdfkaifyvsnfd
    ylvkggrvskfqgfvgnllkirvclhiengelipyrkvrgdkkaiealieklredtpegs
    klrvigvhadneagvvellntlrksyevvdeiispmgkvitthvgpgtvgfgievlerkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpvB (B:)
    mkvkilvdstadvpfswmekydidsiplyvvwedgrsepderepeeimnfykrireagsv
    pktsqpsvedfkkrylkykeedydvvlvltlssklsgtynsavlaskevdipvyvvdtll
    asgaiplparvaremlengatieevlkkldermknkdfkaifyvsnfdylvkggrvllki
    rvclhiengelipyrkvrgdkkaiealieklredtpegsklrvigvhadneagvvellnt
    lrksyevvdeiispmgkvitthvgpgtvgfgievlerk