PDB entry 1vpt

View 1vpt on RCSB PDB site
Description: as11 variant of vaccinia virus protein vp39 in complex with s-adenosyl-l-methionine
Class: methyltransferase
Keywords: RNA cap, poly(a) polymerase, vaccinia, methyltransferase
Deposited on 1996-03-20, released 1996-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.215
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp39
    Species: Vaccinia virus [TaxId:10254]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07617 (15-End)
      • engineered (154)
    Domains in SCOPe 2.07: d1vpta_
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vptA (A:)
    gspgisgggggildsmdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllg
    elfflsklqrhgildgatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilng
    lrdvtlvtrfvdeeylrsikkqlhpskiilisdvasaaggnepstadllsnyalqnvmis
    ilnpvasslkwrcpfpdqwikdfyiphgnkmlqpfapsysaemrllsiytgenmrltrvt
    ksdavnyekkmyylnkivrnkvvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlf
    lqqsifrflnipttstekvshepiqrkissknsmsknrnskrsvrsnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vptA (A:)
    mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
    gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
    lrsikkqlhpskiilisdvaspstadllsnyalqnvmisilnpvasslkwrcpfpdqwik
    dfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyylnkivrnk
    vvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip