PDB entry 1vps

View 1vps on RCSB PDB site
Description: polyomavirus vp1 pentamer complexed with a disialylated hexasaccharide
Deposited on 1997-03-07, released 1997-05-15
The last revision prior to the SCOP 1.55 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1vpsa_
  • Chain 'B':
    Domains in SCOP 1.55: d1vpsb_
  • Chain 'C':
    Domains in SCOP 1.55: d1vpsc_
  • Chain 'D':
    Domains in SCOP 1.55: d1vpsd_
  • Chain 'E':
    Domains in SCOP 1.55: d1vpse_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vpsA (A:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vpsB (B:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvknpyp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vpsC (C:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vpsD (D:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vpsE (E:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk