PDB entry 1vpr

View 1vpr on RCSB PDB site
Description: Crystal structure of a luciferase domain from the dinoflagellate Lingulodinium polyedrum
Class: luminescent protein
Keywords: beta barrel, fatty acid binding protein, lipocalin, luciferase, pH regulation, LUMINESCENT PROTEIN
Deposited on 2004-11-15, released 2005-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: luciferase
    Species: Lingulodinium polyedrum [TaxId:160621]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O77206
      • modified residue (32)
      • modified residue (46)
      • modified residue (91)
      • modified residue (124)
      • modified residue (204)
      • modified residue (266)
      • modified residue (287)
    Domains in SCOPe 2.07: d1vpra1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vprA (A:)
    vcekgfeagdnklggalnakhvekygdnfkngmhkpefhedglhkpmevggkkfesgfhy
    llechelggknasggyggplcedpygsevqamtekllkeadsdrtlcfnnfqdpcpqltk
    eqvamckgfdygdktlklpcgplpwpaglpepgyvpktnplhgrwitvsggqaafikeai
    ksgmlgaaeankivadtdhhqtggmylrinqfgdvctvdasvakfarakrtwksghyfye
    plvsggnllgvwvlpeeyrkigffwemesgrcfrierrafpvgpytfmrqatevggkisf
    vfyvkvsndpesdpiplqsrdytalagrdnaptnlgkpyptlakdldypkkrdgwlekne
    kemlrqrnivsstf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vprA (A:)
    ekgfeagdnklggalnakhvekygdnfkngmhkpefhedglhkpmevggkkfesgfhyll
    echelggknasggyggplcedpygsevqamtekllkeadsdrtlcfnnfqdpcpqltkeq
    vamckgfdygdktlklpcgplpwpaglpepgyvpktnplhgrwitvsggqaafikeaiks
    gmlgaaeankivadtdhhqtggmylrinqfgdvctvdasvakfarakrtwksghyfyepl
    vsggnllgvwvlpeeyrkigffwemesgrcfrierrafpvgpytfmrqatevggkisfvf
    yvkvsndpesdpiplqsrdytalagrdnaptnlgkpyptlakdldypkkrd