PDB entry 1vpq

View 1vpq on RCSB PDB site
Description: CRYSTAL STRUCTURE OF a DUF72 family protein (TM1631) FROM THERMOTOGA MARITIMA MSB8 AT 2.20 A RESOLUTION
Class: unknown function
Keywords: structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, unknown function
Deposited on 2004-11-16, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TM1631
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1631
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1W6 (12-End)
      • leader sequence (11)
    Domains in SCOPe 2.07: d1vpqa1, d1vpqa2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vpqA (A:)
    mgsdkihhhhhhmvyvgtsgfsfedwkgvvypehlkpsqflkyywavlgfrivelnftyy
    tqpswrsfvqmlrktppdfyftvktpgsvthvlwkegkdpkedmenftrqieplieeqrl
    kmtlaqfpfsfkfsrknveyleklresypyelavefrhyswdreetyeflrnhgitfvvv
    depklpglfpyrpitttdyayfrfhgrnerwfeaegeerydylyseeelktlfedvvels
    rrvketyvffnncykgqaainalqfkkmleerv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpqA (A:)
    hmvyvgtsgfsfedwkgvvypehlkpsqflkyywavlgfrivelnftyytqpswrsfvqm
    lrktppdfyftvktpgsvthvlwkegkdpkedmenftrqieplieeqrlkmtlaqfpfsf
    kfsrknveyleklresypyelavefrhyswdreetyeflrnhgitfvvvdepklpglfpy
    rpitttdyayfrfhgrnerwfeaegeerydylyseeelktlfedvvelsrrvketyvffn
    ncykgqaainalqfkkmlee