PDB entry 1vpp

View 1vpp on RCSB PDB site
Description: complex between vegf and a receptor blocking peptide
Deposited on 1998-10-09, released 1999-02-23
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'V':
    Domains in SCOP 1.55: d1vppv_
  • Chain 'W':
    Domains in SCOP 1.55: d1vppw_

PDB Chain Sequences:

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vppV (V:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpkk
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1vppW (W:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vppW (W:)
    evvkfmdvyqrsychpietlvdifieyifkpscvplmrcggccndeglecvpteesnitm
    qimrikphqgqhigemsflqhnkcecrpkk