PDB entry 1vpo

View 1vpo on RCSB PDB site
Description: crystal structure analysis of the anti-testosterone fab in complex with testosterone
Deposited on 2004-11-15, released 2004-11-23
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-11, with a file datestamp of 2005-01-11.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.211
AEROSPACI score: -1.63 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vpoH (H:)
    evklvesggglvkpggslklscaasgftfsryalswvrqtadkrlewvasivsggntyys
    gsvkgrftisrdiarnilylqmsslrsedtamyycarayygyvglvhwgqgtlvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vpoL (L:)
    dvvvtqtplslpvslgdqasiscrssevivtrngytpiewylqkpgqspklliykaykrf
    pgvpdrfsgsgsgtdftlkisrveaedlgvyycfdgstvppkfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrdec