PDB entry 1vpn

View 1vpn on RCSB PDB site
Description: unassembled polyomavirus vp1 pentamer
Class: Viral protein
Keywords: VIRUS COAT PROTEIN, VIRUS ASSEMBLY, Viral protein
Deposited on 1997-03-07, released 1997-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.176
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polyomavirus vp1 pentamer
    Species: Murine polyomavirus [TaxId:10634]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vpna_
  • Chain 'B':
    Compound: polyomavirus vp1 pentamer
    Species: Murine polyomavirus [TaxId:10634]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vpnb_
  • Chain 'C':
    Compound: polyomavirus vp1 pentamer
    Species: Murine polyomavirus [TaxId:10634]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vpnc_
  • Chain 'D':
    Compound: polyomavirus vp1 pentamer
    Species: Murine polyomavirus [TaxId:10634]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vpnd_
  • Chain 'E':
    Compound: polyomavirus vp1 pentamer
    Species: Murine polyomavirus [TaxId:10634]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vpne_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vpnA (A:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpnA (A:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vpnB (B:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvknpyp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vpnC (C:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpnC (C:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vpnD (D:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpnD (D:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vpnE (E:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpnE (E:)
    ggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspg
    nntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntk
    gistpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpi
    skakldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgp
    lckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk