PDB entry 1vpm

View 1vpm on RCSB PDB site
Description: crystal structure of acyl-coa hydrolase (np_241664.1) from bacillus halodurans at 1.66 a resolution
Deposited on 2004-11-11, released 2004-12-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-14, with a file datestamp of 2004-12-14.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.171
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1vpma_
  • Chain 'B':
    Domains in SCOP 1.71: d1vpmb_
  • Chain 'C':
    Domains in SCOP 1.71: d1vpmc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vpmA (A:)
    mgsdkihhhhhhmiqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamk
    hansavvtasidsvdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertltt
    esfltmvavdesgkpkpvpqvepqteeekrlyetaparkenrkkraalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpmA (A:)
    iqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamkhansavvtasids
    vdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertlttesfltmvavdesg
    kpkpvpqvepqteeekrlyetaparkenrkkraal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vpmB (B:)
    mgsdkihhhhhhmiqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamk
    hansavvtasidsvdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertltt
    esfltmvavdesgkpkpvpqvepqteeekrlyetaparkenrkkraalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpmB (B:)
    qsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamkhansavvtasidsv
    dfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertlttesfltmvavdesgk
    pkpvpqvepqteeekrlyetaparkenrkkr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vpmC (C:)
    mgsdkihhhhhhmiqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamk
    hansavvtasidsvdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertltt
    esfltmvavdesgkpkpvpqvepqteeekrlyetaparkenrkkraalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpmC (C:)
    hmiqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamkhansavvtasi
    dsvdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertlttesfltmvavde
    sgkpkpvpqvepqteeekrlyetaparkenrkkr