PDB entry 1vpm

View 1vpm on RCSB PDB site
Description: Crystal structure of Acyl-CoA hydrolase (NP_241664.1) from Bacillus halodurans at 1.66 A resolution
Class: hydrolase
Keywords: NP_241664.1, ACYL-COA HYDROLASE, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, HYDROLASE
Deposited on 2004-11-11, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA hydrolase
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH0798
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KEQ1
      • modified residue (58)
      • modified residue (99)
      • modified residue (125)
    Domains in SCOPe 2.07: d1vpma_
  • Chain 'B':
    Compound: acyl-CoA hydrolase
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH0798
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KEQ1
      • modified residue (58)
      • modified residue (99)
      • modified residue (125)
    Domains in SCOPe 2.07: d1vpmb_
  • Chain 'C':
    Compound: acyl-CoA hydrolase
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH0798
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KEQ1 (12-End)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (58)
      • modified residue (99)
      • modified residue (125)
    Domains in SCOPe 2.07: d1vpmc1, d1vpmc2
  • Heterogens: COA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vpmA (A:)
    mgsdkihhhhhhmiqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamk
    hansavvtasidsvdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertltt
    esfltmvavdesgkpkpvpqvepqteeekrlyetaparkenrkkraalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpmA (A:)
    iqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamkhansavvtasids
    vdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertlttesfltmvavdesg
    kpkpvpqvepqteeekrlyetaparkenrkkraal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vpmB (B:)
    mgsdkihhhhhhmiqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamk
    hansavvtasidsvdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertltt
    esfltmvavdesgkpkpvpqvepqteeekrlyetaparkenrkkraalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpmB (B:)
    qsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamkhansavvtasidsv
    dfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertlttesfltmvavdesgk
    pkpvpqvepqteeekrlyetaparkenrkkr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vpmC (C:)
    mgsdkihhhhhhmiqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamk
    hansavvtasidsvdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertltt
    esfltmvavdesgkpkpvpqvepqteeekrlyetaparkenrkkraalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpmC (C:)
    hmiqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamkhansavvtasi
    dsvdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertlttesfltmvavde
    sgkpkpvpqvepqteeekrlyetaparkenrkkr