PDB entry 1vpl

View 1vpl on RCSB PDB site
Description: Crystal structure of ABC transporter ATP-binding protein (TM0544) from Thermotoga maritima at 2.10 A resolution
Class: lyase
Keywords: TM0544, ABC TRANSPORTER ATP-BINDING PROTEIN, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, LYASE
Deposited on 2004-11-10, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.174
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABC transporter, ATP-binding protein
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0544
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vpla_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vplA (A:)
    mgsdkihhhhhhmgavvvkdlrkrigkkeilkgisfeieegeifgligpngagktttlri
    istlikpssgivtvfgknvveephevrklisylpeeagayrnmqgieylrfvagfyasss
    seieemverateiaglgekikdrvstyskgmvrklliaralmvnprlaildeptsgldvl
    narevrkilkqasqegltilvsshnmleveflcdrialihngtivetgtveelkerykaq
    nieevfeevvkcsenf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vplA (A:)
    gavvvkdlrkrigkkeilkgisfeieegeifgligpngagktttlriistlikpssgivt
    vfgknvveephevrklisylpeeagayrnmqgieylrfvagfyasssseieemveratei
    aglgekikdrvstyskgmvrklliaralmvnprlaildeptsgldvlnarevrkilkqas
    qegltilvsshnmleveflcdrialihngtivetgtveelkerykaqnieevfeevvk