PDB entry 1vpk

View 1vpk on RCSB PDB site
Description: Crystal structure of DNA polymerase III, beta subunit (TM0262) from Thermotoga maritima at 2.00 A resolution
Class: transferase
Keywords: TM0262, DNA Polymerase III, beta subunit, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, TRANSFERASE
Deposited on 2004-11-09, released 2004-11-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase III, beta subunit
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0262
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYA0 (12-377)
      • leader sequence (11)
    Domains in SCOPe 2.06: d1vpka1, d1vpka2, d1vpka3, d1vpka4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vpkA (A:)
    mgsdkihhhhhhmkvtvttlelkdkitiaskalakksvkpilagflfevkdgnfyicatd
    letgvkatvnaaeisgearfvvpgdviqkmvkvlpdeitelslegdalvissgstvfrit
    tmpadefpeitpaesgitfevdtslleemvekvifaaakdefmrnlngvfwelhknllrl
    vasdgfrlalaeeqieneeeasfllslksmkevqnvldntteptitvrydgrrvslstnd
    vetvmrvvdaefpdykrvipetfktkvvvsrkelreslkrvmviaskgsesvkfeieenv
    mrlvskspdygevvdevevqkegedlviafnpkfiedvlkhieteeiemnfvdstspcqi
    npldisgylyivmpirla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpkA (A:)
    hmkvtvttlelkdkitiaskalakksvkpilagflfevkdgnfyicatdletgvkatvna
    aeisgearfvvpgdviqkmvkvlpdeitelslegdalvissgstvfrittmpadefpeit
    paesgitfevdtslleemvekvifaaakdefmrnlngvfwelhknllrlvasdgfrlala
    eeqieneeeasfllslksmkevqnvldntteptitvrydgrrvslstndvetvmrvvdae
    fpdykrvipetfktkvvvsrkelreslkrvmviaskgsesvkfeieenvmrlvskspdyg
    evvdevevqkegedlviafnpkfiedvlkhieteeiemnfvdstspcqinpldisgylyi
    vmpirla