PDB entry 1vpk

View 1vpk on RCSB PDB site
Description: Crystal structure of DNA polymerase III, beta subunit (TM0262) from Thermotoga maritima at 2.00 A resolution
Deposited on 2004-11-09, released 2004-11-23
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-23, with a file datestamp of 2004-11-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vpkA (A:)
    mgsdkihhhhhhmkvtvttlelkdkitiaskalakksvkpilagflfevkdgnfyicatd
    letgvkatvnaaeisgearfvvpgdviqkmvkvlpdeitelslegdalvissgstvfrit
    tmpadefpeitpaesgitfevdtslleemvekvifaaakdefmrnlngvfwelhknllrl
    vasdgfrlalaeeqieneeeasfllslksmkevqnvldntteptitvrydgrrvslstnd
    vetvmrvvdaefpdykrvipetfktkvvvsrkelreslkrvmviaskgsesvkfeieenv
    mrlvskspdygevvdevevqkegedlviafnpkfiedvlkhieteeiemnfvdstspcqi
    npldisgylyivmpirla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpkA (A:)
    hmkvtvttlelkdkitiaskalakksvkpilagflfevkdgnfyicatdletgvkatvna
    aeisgearfvvpgdviqkmvkvlpdeitelslegdalvissgstvfrittmpadefpeit
    paesgitfevdtslleemvekvifaaakdefmrnlngvfwelhknllrlvasdgfrlala
    eeqieneeeasfllslksmkevqnvldntteptitvrydgrrvslstndvetvmrvvdae
    fpdykrvipetfktkvvvsrkelreslkrvmviaskgsesvkfeieenvmrlvskspdyg
    evvdevevqkegedlviafnpkfiedvlkhieteeiemnfvdstspcqinpldisgylyi
    vmpirla