PDB entry 1vpj

View 1vpj on RCSB PDB site
Description: Crystal structure of Fumarase (FUM-1) (NP_069927.1) from Archaeoglobus fulgidus at 1.69 A resolution
Class: lyase
Keywords: NP_069927.1, FUMARASE (FUM-1), Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI
Deposited on 2004-11-04, released 2004-11-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2006-11-28, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.179
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fumarase
    Species: Archaeoglobus fulgidus DSM 4304
    Gene: FUM-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29167
      • modified residue (14)
      • modified residue (57)
      • modified residue (98)
      • modified residue (112)
      • modified residue (120)
      • modified residue (128)
      • modified residue (147)
      • modified residue (162)
    Domains in SCOPe 2.06: d1vpja_
  • Chain 'B':
    Compound: Fumarase
    Species: Archaeoglobus fulgidus DSM 4304
    Gene: FUM-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29167
      • modified residue (14)
      • modified residue (57)
      • modified residue (98)
      • modified residue (112)
      • modified residue (120)
      • modified residue (128)
      • modified residue (147)
      • modified residue (162)
    Domains in SCOPe 2.06: d1vpjb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vpjA (A:)
    mgsdkihhhhhhmvmeyelrtplvkdqilklkvgdvvyitgeiftardeaharalewmee
    gkelpfsfdkgvvyhcgplvkkndewrvvsagpttsarmnpftpkilekvecmgiigkgg
    mseevveamrgkaayfaftggagalaamsikkvkgvvwedlgmpeavwlleverfgpciv
    aidahgnslyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpjA (A:)
    vmeyelrtplvkdqilklkvgdvvyitgeiftardeaharalewmeegkelpfsfdkgvv
    yhcgplvkkndewrvvsagpttsarmnpftpkilekvecmgiigkggmseevveamrgka
    ayfaftggagalaamsikkvkgvvwedlgmpeavwlleverfgpcivaidahgnslyr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vpjB (B:)
    mgsdkihhhhhhmvmeyelrtplvkdqilklkvgdvvyitgeiftardeaharalewmee
    gkelpfsfdkgvvyhcgplvkkndewrvvsagpttsarmnpftpkilekvecmgiigkgg
    mseevveamrgkaayfaftggagalaamsikkvkgvvwedlgmpeavwlleverfgpciv
    aidahgnslyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpjB (B:)
    vmeyelrtplvkdqilklkvgdvvyitgeiftardeaharalewmeegkelpfsfdkgvv
    yhcgplvkkndewrvvsagpttsarmnpftpkilekvecmgiigkggmseevveamrgka
    ayfaftggagalaamsikkvkgvvwedlgmpeavwlleverfgpcivaidahgnslyr