PDB entry 1vpi

View 1vpi on RCSB PDB site
Description: phospholipase a2 inhibitor from vipoxin
Class: neurotoxin
Keywords: phospholipase a2 inhibitor, recognition, molecular evolution, neurotoxin
Deposited on 1996-12-17, released 1997-12-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2 inhibitor
  Species: Vipera ammodytes [TaxId:8704]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04084 (0-121)
  Domains in SCOPe 2.08: d1vpia_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vpiA (A:)
  nlfqfgdmilqktgkeavhsyaiygcycgwggqgraqdatdrccfaqdccygrvndcnpk
  tatytysfengdivcgdndlclravcecdraaaiclgenvntydknyeyysishcteese
  qc