PDB entry 1vpi

View 1vpi on RCSB PDB site
Description: phospholipase a2 inhibitor from vipoxin
Class: neurotoxin
Keywords: phospholipase a2 inhibitor, recognition, molecular evolution, neurotoxin
Deposited on 1996-12-17, released 1997-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2 inhibitor
    Species: Vipera ammodytes [TaxId:8704]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vpia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vpiA (A:)
    nlfqfgdmilqktgkeavhsyaiygcycgwggqgraqdatdrccfaqdccygrvndcnpk
    tatytysfengdivcgdndlclravcecdraaaiclgenvntydknyeyysishcteese
    qc