PDB entry 1vph

View 1vph on RCSB PDB site
Description: CRYSTAL STRUCTURE OF a YbjQ-like protein of unknown function (SSO2532) FROM SULFOLOBUS SOLFATARICUS P2 AT 1.76 A RESOLUTION
Class: unknown function
Keywords: ybjq-like fold, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, unknown function
Deposited on 2004-11-03, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein SSO2532
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97VS8 (12-148)
      • leader sequence (11)
    Domains in SCOPe 2.07: d1vpha1, d1vpha2
  • Chain 'B':
    Compound: hypothetical protein SSO2532
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vphb_
  • Chain 'C':
    Compound: hypothetical protein SSO2532
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97VS8 (12-148)
      • leader sequence (5-11)
    Domains in SCOPe 2.07: d1vphc1, d1vphc2
  • Chain 'D':
    Compound: hypothetical protein SSO2532
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97VS8 (12-148)
      • leader sequence (11)
    Domains in SCOPe 2.07: d1vphd1, d1vphd2
  • Chain 'E':
    Compound: hypothetical protein SSO2532
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97VS8 (12-148)
      • leader sequence (11)
    Domains in SCOPe 2.07: d1vphe1, d1vphe2
  • Chain 'F':
    Compound: hypothetical protein SSO2532
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97VS8 (12-148)
      • leader sequence (6-11)
    Domains in SCOPe 2.07: d1vphf1, d1vphf2
  • Heterogens: K, PO4, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vphA (A:)
    mgsdkihhhhhhmkvyfddiyvstarqfelvditdqveqiveksgikngiclifvahsta
    aivaneherglmediltkikeftepsrswkhnliddnahahlgatflgaervfpvregkl
    vrgtwqniflveldgprserhitveilge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vphA (A:)
    hmkvyfddiyvstarqfelvditdqveqiveksgikngiclifvahstaaivanehergl
    mediltkikeftepsrswkhnliddnahahlgatflgaervfpvregklvrgtwqniflv
    eldgprserhitveilge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vphB (B:)
    mgsdkihhhhhhmkvyfddiyvstarqfelvditdqveqiveksgikngiclifvahsta
    aivaneherglmediltkikeftepsrswkhnliddnahahlgatflgaervfpvregkl
    vrgtwqniflveldgprserhitveilge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vphB (B:)
    mkvyfddiyvstarqfelvditdqveqiveksgikngiclifvahstaaivaneherglm
    ediltkikeftepsrswkhnliddnahahlgatflgaervfpvregklvrgtwqniflve
    ldgprserhitveilge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vphC (C:)
    mgsdkihhhhhhmkvyfddiyvstarqfelvditdqveqiveksgikngiclifvahsta
    aivaneherglmediltkikeftepsrswkhnliddnahahlgatflgaervfpvregkl
    vrgtwqniflveldgprserhitveilge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vphC (C:)
    ihhhhhhmkvyfddiyvstarqfelvditdqveqiveksgikngiclifvahstaaivan
    eherglmediltkikeftepsrswkhnliddnahahlgatflgaervfpvregklvrgtw
    qniflveldgprserhitveilge
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vphD (D:)
    mgsdkihhhhhhmkvyfddiyvstarqfelvditdqveqiveksgikngiclifvahsta
    aivaneherglmediltkikeftepsrswkhnliddnahahlgatflgaervfpvregkl
    vrgtwqniflveldgprserhitveilge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vphD (D:)
    hmkvyfddiyvstarqfelvditdqveqiveksgikngiclifvahstaaivanehergl
    mediltkikeftepsrswkhnliddnahahlgatflgaervfpvregklvrgtwqniflv
    eldgprserhitveilge
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vphE (E:)
    mgsdkihhhhhhmkvyfddiyvstarqfelvditdqveqiveksgikngiclifvahsta
    aivaneherglmediltkikeftepsrswkhnliddnahahlgatflgaervfpvregkl
    vrgtwqniflveldgprserhitveilge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vphE (E:)
    hmkvyfddiyvstarqfelvditdqveqiveksgikngiclifvahstaaivanehergl
    mediltkikeftepsrswkhnliddnahahlgatflgaervfpvregklvrgtwqniflv
    eldgprserhitveilge
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vphF (F:)
    mgsdkihhhhhhmkvyfddiyvstarqfelvditdqveqiveksgikngiclifvahsta
    aivaneherglmediltkikeftepsrswkhnliddnahahlgatflgaervfpvregkl
    vrgtwqniflveldgprserhitveilge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vphF (F:)
    hhhhhhmkvyfddiyvstarqfelvditdqveqiveksgikngiclifvahstaaivane
    herglmediltkikeftepsrswkhnliddnahahlgatflgaervfpvregklvrgtwq
    niflveldgprserhitveilge