PDB entry 1vpe

View 1vpe on RCSB PDB site
Description: crystallographic analysis of phosphoglycerate kinase from the hyperthermophilic bacterium thermotoga maritima
Deposited on 1997-05-06, released 1998-06-17
The last revision prior to the SCOP 1.55 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1vpe__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vpe_ (-)
    ekmtirdvdlkgkrvimrvdfnvpvkdgvvqddtriraalptikyaleqgakvillshlg
    rpkgepspefslapvakrlsellgkevkfvpavvgdevkkaveelkegevlllentrfhp
    getkndpelakfwasladihvndafgtahrahasnvgiaqfipsvagflmekeikflskv
    tynpekpyvvvlggakvsdkigvitnlmekadriliggammftflkalgkevgssrveed
    kidlakelvekakekgveivlpvdaviaqkiepgvekkvvriddgipegwmgldigpeti
    elfkqklsdaktvvwngpmgvfeiddfaegtkqvalaiaaltekgaitvvgggdsaaavn
    kfgledkfshvstgggasleflegkelpgiasmrikka