PDB entry 1vpe

View 1vpe on RCSB PDB site
Description: crystallographic analysis of phosphoglycerate kinase from the hyperthermophilic bacterium thermotoga maritima
Class: transferase
Keywords: transferase, phosphoglycerate kinase, thermotoga maritima, hyperthermostability, crystal, amp-pnp, 3-pga
Deposited on 1997-05-06, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate kinase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36204 (0-396)
      • correction (248)
      • conflict (392-394)
    Domains in SCOPe 2.07: d1vpea_
  • Heterogens: MG, ANP, 3PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vpeA (A:)
    ekmtirdvdlkgkrvimrvdfnvpvkdgvvqddtriraalptikyaleqgakvillshlg
    rpkgepspefslapvakrlsellgkevkfvpavvgdevkkaveelkegevlllentrfhp
    getkndpelakfwasladihvndafgtahrahasnvgiaqfipsvagflmekeikflskv
    tynpekpyvvvlggakvsdkigvitnlmekadriliggammftflkalgkevgssrveed
    kidlakelvekakekgveivlpvdaviaqkiepgvekkvvriddgipegwmgldigpeti
    elfkqklsdaktvvwngpmgvfeiddfaegtkqvalaiaaltekgaitvvgggdsaaavn
    kfgledkfshvstgggasleflegkelpgiasmrikka