PDB entry 1vpd

View 1vpd on RCSB PDB site
Description: X-Ray Crystal Structure of Tartronate Semialdehyde Reductase [Salmonella Typhimurium LT2]
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, MCSG, PROTEIN STRUCTURE INITIATIVE, REDUCTASE, TARTRONATE, PSI, Midwest Center for Structural Genomics, OXIDOREDUCTASE
Deposited on 2004-10-22, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.121
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tartronate semialdehyde reductase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: GARR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vpda1, d1vpda2
  • Heterogens: CL, TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vpdA (A:)
    snamtmkvgfiglgimgkpmsknllkagyslvvsdrnpeaiadviaagaetastakaiae
    qcdviitmlpnsphvkevalgengiiegakpgtvlidmssiaplasreisdalkakgvem
    ldapvsggepkaidgtlsvmvggdkaifdkyydlmkamagsvvhtgdigagnvtklanqv
    ivalniaamsealtlatkagvnpdlvyqairgglagstvldakapmvmdrnfkpgfridl
    hikdlanaldtshgvgaqlpltaavmemmqalradghgnddhsalacyyeklakvevtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpdA (A:)
    mkvgfiglgimgkpmsknllkagyslvvsdrnpeaiadviaagaetastakaiaeqcdvi
    itmlpnsphvkevalgengiiegakpgtvlidmssiaplasreisdalkakgvemldapv
    sggepkaidgtlsvmvggdkaifdkyydlmkamagsvvhtgdigagnvtklanqvivaln
    iaamsealtlatkagvnpdlvyqairgglagstvldakapmvmdrnfkpgfridlhikdl
    analdtshgvgaqlpltaavmemmqalradghgnddhsalacyyeklakvevtr