PDB entry 1vpc

View 1vpc on RCSB PDB site
Description: c-terminal domain (52-96) of the hiv-1 regulatory protein vpr, nmr, 1 structure
Class: regulatory protein
Keywords: regulatory protein, helical domain, leucine-zipper
Deposited on 1998-02-20, released 1999-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vpr protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vpca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vpcA (A:)
    dtwtgvealirilqqllfihfrigcrhsrigiiqqrrtrngasks