PDB entry 1vpb

View 1vpb on RCSB PDB site
Description: crystal structure of a putative modulator of DNA gyrase (bt3649) from bacteroides thetaiotaomicron vpi-5482 at 1.75 a resolution
Class: hydrolase
Keywords: putative modulator of DNA gyrase, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, hydrolase
Deposited on 2004-10-15, released 2004-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.18
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative modulator of DNA gyrase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: bt3649
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vpba_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vpbA (A:)
    mgsdkihhhhhhmitdenkklaqwamdyalkngcqaakvllysssntsfelrdakmdrlq
    qasegglslslyvdgrygsistnrlnrkeletfikngidstrylakdearvladpsryyk
    ggkpdlklydakfaslnpddkiemakavaeealgkderiisvgssygdgedfayrlisng
    fegetkstwyslsaditirgegearpsaywyesslymndlikkgigqkalervlrklgqk
    kvqsgkytmvvdpmnssrllspmisalngsalqqknsfllnklnekiasdrltltdephl
    vkasgaryfdnegiaterrsifdkgvlntyfidtynakkmgvdptisgssilvmetgdkn
    ldgliagvekgilvtgfnggnnnsstgdfsygiegfliengkltqpvsemnvtgnlitlw
    nslvatgndprlnsswripslvfegvdfsgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpbA (A:)
    mitdenkklaqwamdyalkngcqaakvllysssntsfelrdmdrlqqasegglslslyvd
    grygsistnrlnrkeletfikngidstrylakdearvladpsryykggkpdlklydakfa
    slnpddkiemakavaeealgkderiisvgssygdgedfayrlisngfegetkstwyslsa
    ditirgegearpsaywyesslymndlikkgigqkalervlrklgqkkvqsgkytmvvdpm
    nssrllspmisalngsalqqknsfllnklnekiasdrltltdephlvkasgaryfdnegi
    aterrsifdkgvlntyfidtynakkmgvdptisgssilvmetgdknldgliagvekgilv
    tgfnggnnnsstgdfsygiegfliengkltqpvsemnvtgnlitlwnslvatgndprlns
    swripslvfegvdfsgl