PDB entry 1vpa

View 1vpa on RCSB PDB site
Description: Crystal structure of 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (TM1393) from Thermotoga maritima at 2.67 A resolution
Class: transferase
Keywords: TM1393, 2-C-methyl-d-erythritol 4-phosphate cytidylyltransferase, structural genomics, JCSG, Joint Center for Structural Genomics, PSI, protein structure initiative, TRANSFERASE
Deposited on 2004-10-14, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.67 Å
R-factor: 0.202
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1393, ispD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1B3 (12-End)
      • leader sequence (10-11)
    Domains in SCOPe 2.07: d1vpaa1, d1vpaa2
  • Chain 'B':
    Compound: 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1393, ispD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1B3 (12-End)
      • leader sequence (10-11)
    Domains in SCOPe 2.07: d1vpab1, d1vpab2
  • Heterogens: MG, CTP, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vpaA (A:)
    mgsdkihhhhhhmnvaillaagkgermsenvpkqfleiegrmlfeyplstflkseaidgv
    vivtrrewfevvekrvfhekvlgiveggdtrsqsvrsaleflekfspsyvlvhdsarpfl
    rkkhvsevlrraretgaatlalknsdalvrvendrieyiprkgvyriltpqafsyeilkk
    ahenggewaddtepvqklgvkialvegdplcfkvtfkedlelariiarewerip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpaA (A:)
    hhmnvaillaagkgermsenvpkqfleiegrmlfeyplstflkseaidgvvivtrrewfe
    vvekrvfhekvlgiveggdtrsqsvrsaleflekfspsyvlvhdsarpflrkkhvsevlr
    raretgaatlalknsdalvrvendrieyiprkgvyriltpqafsyeilkkahenggewad
    dtepvqklgvkialvegdplcfkvtfkedlelariiarewe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vpaB (B:)
    mgsdkihhhhhhmnvaillaagkgermsenvpkqfleiegrmlfeyplstflkseaidgv
    vivtrrewfevvekrvfhekvlgiveggdtrsqsvrsaleflekfspsyvlvhdsarpfl
    rkkhvsevlrraretgaatlalknsdalvrvendrieyiprkgvyriltpqafsyeilkk
    ahenggewaddtepvqklgvkialvegdplcfkvtfkedlelariiarewerip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpaB (B:)
    hhmnvaillaagkgermsenvpkqfleiegrmlfeyplstflkseaidgvvivtrrewfe
    vvekrvfhekvlgiveggdtrsqsvrsaleflekfspsyvlvhdsarpflrkkhvsevlr
    raretgaatlalknsdalvrvendrieyiprkgvyriltpqafsyeilkkahenggewad
    dtepvqklgvkialvegdplcfkvtfkedlelariiarew