PDB entry 1vp7

View 1vp7 on RCSB PDB site
Description: crystal structure of exodeoxyribonuclease vii small subunit (np_881400.1) from bordetella pertussis at 2.40 a resolution
Deposited on 2004-10-14, released 2004-10-26
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-26, with a file datestamp of 2004-10-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.205
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1vp7a_
  • Chain 'B':
    Domains in SCOP 1.71: d1vp7b_
  • Chain 'C':
    Domains in SCOP 1.71: d1vp7c_
  • Chain 'D':
    Domains in SCOP 1.71: d1vp7d_
  • Chain 'E':
    Domains in SCOP 1.71: d1vp7e_
  • Chain 'F':
    Domains in SCOP 1.71: d1vp7f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vp7A (A:)
    mgsdkihhhhhhmasskqadpqtdarplpqdfetalaeleslvsamengtlpleqslsay
    rrgvelarvcqdrlaqaeqqvkvlegdllrpldpaaldde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vp7A (A:)
    arplpqdfetalaeleslvsamengtlpleqslsayrrgvelarvcqdrlaqaeqqvkvl
    egdllrpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vp7B (B:)
    mgsdkihhhhhhmasskqadpqtdarplpqdfetalaeleslvsamengtlpleqslsay
    rrgvelarvcqdrlaqaeqqvkvlegdllrpldpaaldde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vp7B (B:)
    qtdarplpqdfetalaeleslvsamengtlpleqslsayrrgvelarvcqdrlaqaeqqv
    kvlegdllrpldpaald
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vp7C (C:)
    mgsdkihhhhhhmasskqadpqtdarplpqdfetalaeleslvsamengtlpleqslsay
    rrgvelarvcqdrlaqaeqqvkvlegdllrpldpaaldde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vp7C (C:)
    pqtdarplpqdfetalaeleslvsamengtlpleqslsayrrgvelarvcqdrlaqaeqq
    vkvlegdllrp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vp7D (D:)
    mgsdkihhhhhhmasskqadpqtdarplpqdfetalaeleslvsamengtlpleqslsay
    rrgvelarvcqdrlaqaeqqvkvlegdllrpldpaaldde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vp7D (D:)
    arplpqdfetalaeleslvsamelpleqslsayrrgvelarvcqdrlaqaeqqvkvlegd
    llrpldpaa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vp7E (E:)
    mgsdkihhhhhhmasskqadpqtdarplpqdfetalaeleslvsamengtlpleqslsay
    rrgvelarvcqdrlaqaeqqvkvlegdllrpldpaaldde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vp7E (E:)
    arplpqdfetalaeleslvsamengtlpleqslsayrrgvelarvcqdrlaqaeqqvkvl
    egdllrp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vp7F (F:)
    mgsdkihhhhhhmasskqadpqtdarplpqdfetalaeleslvsamengtlpleqslsay
    rrgvelarvcqdrlaqaeqqvkvlegdllrpldpaaldde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vp7F (F:)
    arplpqdfetalaeleslvsamenlpleqslsayrrgvelarvcqdrlaqaeqqvkvleg
    dllrp