PDB entry 1vp7

View 1vp7 on RCSB PDB site
Description: Crystal structure of Exodeoxyribonuclease VII small subunit (NP_881400.1) from Bordetella pertussis at 2.40 A resolution
Class: hydrolase
Keywords: NP_881400.1, Exodeoxyribonuclease VII small subunit E.C.3.1.11.6, structural genomics, Joint Center for Structural Genomics, JCSG, PSI, Protein Structure Initiative, HYDROLASE
Deposited on 2004-10-14, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exodeoxyribonuclease VII small subunit
    Species: Bordetella pertussis [TaxId:257313]
    Gene: NP_881400.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7W7Q2
      • modified residue (45)
    Domains in SCOPe 2.07: d1vp7a_
  • Chain 'B':
    Compound: exodeoxyribonuclease VII small subunit
    Species: Bordetella pertussis [TaxId:257313]
    Gene: NP_881400.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7W7Q2
      • modified residue (45)
    Domains in SCOPe 2.07: d1vp7b_
  • Chain 'C':
    Compound: exodeoxyribonuclease VII small subunit
    Species: Bordetella pertussis [TaxId:257313]
    Gene: NP_881400.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7W7Q2
      • modified residue (45)
    Domains in SCOPe 2.07: d1vp7c_
  • Chain 'D':
    Compound: exodeoxyribonuclease VII small subunit
    Species: Bordetella pertussis [TaxId:257313]
    Gene: NP_881400.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7W7Q2
      • modified residue (45)
    Domains in SCOPe 2.07: d1vp7d_
  • Chain 'E':
    Compound: exodeoxyribonuclease VII small subunit
    Species: Bordetella pertussis [TaxId:257313]
    Gene: NP_881400.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7W7Q2
      • modified residue (45)
    Domains in SCOPe 2.07: d1vp7e_
  • Chain 'F':
    Compound: exodeoxyribonuclease VII small subunit
    Species: Bordetella pertussis [TaxId:257313]
    Gene: NP_881400.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7W7Q2
      • modified residue (45)
    Domains in SCOPe 2.07: d1vp7f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vp7A (A:)
    mgsdkihhhhhhmasskqadpqtdarplpqdfetalaeleslvsamengtlpleqslsay
    rrgvelarvcqdrlaqaeqqvkvlegdllrpldpaaldde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vp7A (A:)
    arplpqdfetalaeleslvsamengtlpleqslsayrrgvelarvcqdrlaqaeqqvkvl
    egdllrpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vp7B (B:)
    mgsdkihhhhhhmasskqadpqtdarplpqdfetalaeleslvsamengtlpleqslsay
    rrgvelarvcqdrlaqaeqqvkvlegdllrpldpaaldde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vp7B (B:)
    qtdarplpqdfetalaeleslvsamengtlpleqslsayrrgvelarvcqdrlaqaeqqv
    kvlegdllrpldpaald
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vp7C (C:)
    mgsdkihhhhhhmasskqadpqtdarplpqdfetalaeleslvsamengtlpleqslsay
    rrgvelarvcqdrlaqaeqqvkvlegdllrpldpaaldde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vp7C (C:)
    pqtdarplpqdfetalaeleslvsamengtlpleqslsayrrgvelarvcqdrlaqaeqq
    vkvlegdllrp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vp7D (D:)
    mgsdkihhhhhhmasskqadpqtdarplpqdfetalaeleslvsamengtlpleqslsay
    rrgvelarvcqdrlaqaeqqvkvlegdllrpldpaaldde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vp7D (D:)
    arplpqdfetalaeleslvsamelpleqslsayrrgvelarvcqdrlaqaeqqvkvlegd
    llrpldpaa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vp7E (E:)
    mgsdkihhhhhhmasskqadpqtdarplpqdfetalaeleslvsamengtlpleqslsay
    rrgvelarvcqdrlaqaeqqvkvlegdllrpldpaaldde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vp7E (E:)
    arplpqdfetalaeleslvsamengtlpleqslsayrrgvelarvcqdrlaqaeqqvkvl
    egdllrp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vp7F (F:)
    mgsdkihhhhhhmasskqadpqtdarplpqdfetalaeleslvsamengtlpleqslsay
    rrgvelarvcqdrlaqaeqqvkvlegdllrpldpaaldde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vp7F (F:)
    arplpqdfetalaeleslvsamenlpleqslsayrrgvelarvcqdrlaqaeqqvkvleg
    dllrp