PDB entry 1vp5

View 1vp5 on RCSB PDB site
Description: Crystal structure of 2,5-diketo-D-gluconic acid reductase (TM1009) from Thermotoga maritima at 2.40 A resolution
Class: oxidoreductase
Keywords: TM1009, 2, 5-diketo-d-gluconic acid reductase (ec 1.1.1.274), structural genomics, Joint Center for Structural Genomics, JCSG, PSI, Protein Structure Initiative, OXIDOREDUCTASE
Deposited on 2004-10-13, released 2004-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,5-diketo-d-gluconic acid reductase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vp5a_
  • Chain 'B':
    Compound: 2,5-diketo-d-gluconic acid reductase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vp5b_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vp5A (A:)
    mgsdkihhhhhhmqvpkvtlnngvempilgygvfqippekteecvyeaikvgyrlidtaa
    symneegvgraikraidegivrreelfvttklwvsdvgyestkkafekslkklqleyidl
    ylihqpfgdvhcawkameemykdglvraigvsnfypdrlmdlmvhheivpavnqieihpf
    yqrqeeiefmrnyniqpeawgpfaegrknifqngvlrsiaekygktvaqvilrwltqkgi
    vaipktvrrermkenisifdfeltqedmekiatldegqsaffshrdpevvkwicslkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vp5A (A:)
    qvpkvtlnngvempilgygvfqippekteecvyeaikvgyrlidtaasymneegvgraik
    raidegivrreelfvttklwvsdvgyestkkafekslkklqleyidlylihqpfgdvhca
    wkameemykdglvraigvsnfypdrlmdlmvhheivpavnqieihpfyqrqeeiefmrny
    niqpeawgpfaegrknifqngvlrsiaekygktvaqvilrwltqkgivaipktvrrermk
    enisifdfeltqedmekiatldegqsaffshrdpevvkwicslk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vp5B (B:)
    mgsdkihhhhhhmqvpkvtlnngvempilgygvfqippekteecvyeaikvgyrlidtaa
    symneegvgraikraidegivrreelfvttklwvsdvgyestkkafekslkklqleyidl
    ylihqpfgdvhcawkameemykdglvraigvsnfypdrlmdlmvhheivpavnqieihpf
    yqrqeeiefmrnyniqpeawgpfaegrknifqngvlrsiaekygktvaqvilrwltqkgi
    vaipktvrrermkenisifdfeltqedmekiatldegqsaffshrdpevvkwicslkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vp5B (B:)
    qvpkvtlnngvempilgygvfqippekteecvyeaikvgyrlidtaasymneegvgraik
    raidegivrreelfvttklwvsdvgyestkkafekslkklqleyidlylihqpfgdvhca
    wkameemykdglvraigvsnfypdrlmdlmvhheivpavnqieihpfyqrqeeiefmrny
    niqpeawgpfaegrknifqngvlrsiaekygktvaqvilrwltqkgivaipktvrrermk
    enisifdfeltqedmekiatldegqsaffshrdpevvkwicsl