PDB entry 1vp4

View 1vp4 on RCSB PDB site
Description: Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 A resolution
Deposited on 2004-10-08, released 2004-10-26
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-26, with a file datestamp of 2004-10-26.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.18
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1vp4a_
  • Chain 'B':
    Domains in SCOP 1.71: d1vp4b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vp4A (A:)
    mgsdkihhhhhhmvvnlegkiskigqnmkssiireilkfaadkdaisfgggvpdpetfpr
    kelaeiakeiiekeyhytlqysttegdpvlkqqilkllermygitgldednliftvgsqq
    aldligklflddesycvlddpaylgainafrqylanfvvvpleddgmdlnvlerklsefd
    kngkikqvkfiyvvsnfhnpagvttslekrkalveiaekydlfiveddpygalryegetv
    dpifkiggpervvllntfskvlapglrigmvagskefirkivqakqsadlcspaithrla
    arylerydlleqlkptielyrrkrtvmlnaleeyfsdipgvkwvksegglfiwltlpegf
    dtwemfeyakrkkvfyvpgrvfkvydepspsmrlsfclppdekivegikrlrevvleygk
    ekhll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vp4A (A:)
    ihhhhhhmvvnlegkiskigqnmkssiireilkfaadkdaisfgggvpdpetfprkelae
    iakeiiekeyhytlqysttegdpvlkqqilkllermygitgldednliftvgsqqaldli
    gklflddesycvlddpaylgainafrqylanfvvvpleddgmdlnvlerklsefdkngki
    kqvkfiyvvsnfhnpagvttslekrkalveiaekydlfiveddpygalryegetvdpifk
    iggpervvllntfskvlapglrigmvagskefirkivqakqsadlcspaithrlaaryle
    rydlleqlkptielyrrkrtvmlnaleeyfsdipgvkwvksegglfiwltlpegfdtwem
    feyakrkkvfyvpgrvfkvydepspsmrlsfclppdekivegikrlrevvleygkekhll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vp4B (B:)
    mgsdkihhhhhhmvvnlegkiskigqnmkssiireilkfaadkdaisfgggvpdpetfpr
    kelaeiakeiiekeyhytlqysttegdpvlkqqilkllermygitgldednliftvgsqq
    aldligklflddesycvlddpaylgainafrqylanfvvvpleddgmdlnvlerklsefd
    kngkikqvkfiyvvsnfhnpagvttslekrkalveiaekydlfiveddpygalryegetv
    dpifkiggpervvllntfskvlapglrigmvagskefirkivqakqsadlcspaithrla
    arylerydlleqlkptielyrrkrtvmlnaleeyfsdipgvkwvksegglfiwltlpegf
    dtwemfeyakrkkvfyvpgrvfkvydepspsmrlsfclppdekivegikrlrevvleygk
    ekhll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vp4B (B:)
    hhhmvvnlegkiskigqnmkssiireilkfaadkdaisfgggvpdpetfprkelaeiake
    iiekeyhytlqysttegdpvlkqqilkllermygitgldednliftvgsqqaldligklf
    lddesycvlddpaylgainafrqylanfvvvpleddgmdlnvlerklsefdkngkikqvk
    fiyvvsnfhnpagvttslekrkalveiaekydlfiveddpygalryegetvdpifkiggp
    ervvllntfskvlapglrigmvagskefirkivqakqsadlcspaithrlaarylerydl
    leqlkptielyrrkrtvmlnaleeyfsdipgvkwvksegglfiwltlpegfdtwemfeya
    krkkvfyvpgrvfkvydepspsmrlsfclppdekivegikrlrevvleygkekhll